Etymologie, Étymologie, Etymology
Wortgeschichte & Wortgeschichten
In Planung 64

  • adversativ
  • adversativ (W3)

    Dt. "adversativ" = "entgegensetzend" geht zurück auf lat. "adversari" = "gegenüberstellen", und setzt sich zusammen aus lat. "-ad-" = dt. "bis", "bis zu", "gegen", "nach", "zu" und lat. "versari" = dt. "drehen", "wälzen".

    Vgl.: dt. "versiert (sein)" = "erfahren sein" bedeutet wörtlich "gewandt sein". Böswillig könnte man "versiert" auch mit "Wendehals" in Verbindung bringen.

    Aadversative Bindeworte sind z.B. "aber", "dabei", "doch", "indes", "trotz", "ungeachtet", "während", "wohingegen".

    Erstellt: 2010-06

  • Akkusativ
  • Akkusativ (W3)

    Dt. "Akkusativ" = "Wenfall" geht zurück auf lat. "(casus) accusativus" = wörtlich "die Anklage betreffend(er Fall)", und basiert auf lat. "accusare" = "anklagen".

    Im Englischen hat bis heute engl. "accuse" = dt. "anklagen", "beschuldigen" überlebt. Und die "Befreiung von Schuld" erbittet man mit engl. "excuse me" = wörtlich etwa "entschuldigen Sie mich bitte".

    Erstellt: 2010-06

  • Aktiv
  • Aktiv (W3)

    Die Verbform dt. "Aktiv" geht zurück auf lat. "(genus) activum" = dt. "Tätigkeitsform".

    Erstellt: 2010-06

  • Artikel
  • Artikel (W3)

    Der dt. "Artikel" (auch dt. "Geschlechtswort") ist ein Wort, das Geschlecht, Fall und Zahl eines Substantivs angibt. Der "Artikel" tritt auf als bestimmter Artikel "der", "die", "das", oder als unbestimmter Artikel "ein", "eine". Der "Artikel" setzt sich zusammen aus lat. "articulus" = dt. "Abschnitt", "Teilchen" und lat. "artus" = dt. "Gelenk", "Glied".

    Erstellt: 2010-03

  • attributiv
  • attributiv (W3)

    Dt. "attributiv" = dt. "beigefügt" geht zurück auf lat. "attribuere" = dt. "zuteilen", "verleihen", "beifügen". Das Verb lat. "attribuere" setzt sich zusammen aus lat. "ad-" = dt. "zu", "nach" und lat. "tribuere", ("Tribut"), = dt. "einteilen" dessen erster Teil aus lat. "tri" = dt. "drei" besteht. Lat. "Tribus" war "einer der drei ältesten Stämme des antiken Rom".

    Ganz eindeutig erschließt sich mir die Herleitung nicht. Villeicht handelt es sich um eine Dativbildung mit der Bedeutung "einem der drei (Stämme gehörendes)".

    Erstellt: 2010-03

  • Dativ
  • Dativ (W3)

    Der dt. "Dativ", dt. "Wemfall", geht zurück auf lat. "casus dativus" = "das Geben betreffender Fall". "Lat. "dativus" geht weiter zurück auf lat. "dare" = dt. "geben", "ausfertigen", "schreiben", worauf auch das "Datum" und die "Daten" = "das Gegebene" zurück geht.

    Erstellt: 2010-03

  • Demonstrativpronomen
  • Demonstrativpronomen (W3)

    Dt. "Demonstrativpronomen" = dt. "hinweisendes Fürwort", "Pronomen, das auf etwas hinweist". Das "Demonstrativpronomen" setzt sich zusammen aus lat. "demonstrativus" = "hinzeigend" und lat. "pronomen", das sich wiederum aus lat. "pro" = dt. "für", "anstatt" und lat. "nomen" = dt. "Name" zusammensetzt.

    Erstellt: 2010-03

  • elliptisch
  • elliptisch (W3)

    Dt. "elliptisch" = dt. "eine Auslassung von Satzteilen enthaltend", "unvollständig", setzt sich zusammen aus lat. "ellipsis", griech. "élleipsis" = dt. "das Auslassen".

    Die geometrische "Ellipse" verdankt ihre Bezeichnung vermutlich der Tatsache, dass ihr etwas zur Vollkommenheit des Kreises fehlt.

    Erstellt: 2010-03

  • flektiert
  • flektiert (W3)

    Dt. "flektiert" = dt. "gebeugt" (nach Fall, Geschlecht oder Zahl) geht zurück auf lat. "flectere" = dt. "biegen", "beugen".

    Erstellt: 2010-03

  • final
  • final (W3)

    Dt. "final" = dt. "den Zweck betreffend", "eine Absicht kennzeichnend", geht zurück auf lat. "finalis" = dt. "die Grenze betreffend", "das Ende betreffend" und lat. "finis" = dt. "Ende".

    Erstellt: 2010-03

  • Genitiv
  • Genitiv (W3)

    Dt. "Genitiv" = dt. "Wesfall" geht zurück auf lat. "casus genitivus" = "die Herkunft bezeichnender Fall", "die Zugehörigkeit bezeichnender Fall". Dem Wort "Genitiv" liegt lat. "generare" = "hervorbringen", "erzeugen" zu Grunde (vgl. dt. "generieren").

    Erstellt: 2010-03

  • Imperativ
  • Imperativ (W3)

    Dt. "Imperativ" = dt. "Befehlsform", geht zurück auf lat. "imperare" = "befehlen".

    Erstellt: 2010-03

  • Indefinitpronomen
  • Indefinitpronomen (W3)

    Dt. "Indefinitpronomen" = dt. "unbestimmtes Fürwort", setzt sich zusammen aus lat. "in-" = dt. "un-", lat. "definitus" = dt. "bestimmt", "festgelegt", lat. "pro" = dt. "für", "anstatt" und lat. "nomen" = dt. "Name".

    Erstellt: 2010-03

  • indeklinabel
  • indeklinabel (W3)

    Dt. "indeklinabel" = dt. "undeklinierbar", "nicht beugbar", setzt sich zusammen aus lat. "in-" = dt. "un-" und lat. "declinare" = dt. "abbiegen".

    Erstellt: 2010-03

  • Indikativ
  • Indikativ (W3)

    Dt. "Indikativ" = dt. "Wirklichkeitsform", setzt sich zusammen aus lat. "indicare" = dt. "indizieren", "anzeigen" (vgl. lat. "index" = "Anzeiger", "Register", "Verzeichnis").

    Erstellt: 2010-03

  • Aetate fruere! Mobili cursu fugit.
  • Aetate fruere! Mobili cursu fugit. (W3)

    Der Rat lat. "Aetate fruere! Mobili cursu fugit." = dt. "Genieße das Leben! Es flieht in schnellem Lauf dahin." ist in dem Werk "Phaedra" (446) des römischen Schriftstellers Lucius Annaeus Seneca (-4 - 65) zu finden.

    Erstellt: 2010-06

  • 1916-06-14 - Flag Day in USA
  • Flag Day in USA - 1916-06-14
  • 1916-06-14
    Flag Day in USA (W3)

    Im Jahr 1916 erklärte Präsident Woodrow Wilson den 14. Juni zum "Flaggentag der USA". An diesem Tag wurde im Jahr 1777 die US-Flagge per Beschluß auf dem "Second Continental Congress" angemommen.

    (E?)(L?) http://en.wikipedia.org/wiki/Flag_Day_(United_States)
    In the United States, Flag Day is celebrated on June 14. It commemorates the adoption of the flag of the United States, which happened that day by resolution of the Second Continental Congress in 1777.

    In 1916, President Woodrow Wilson issued a proclamation that officially established June 14 as Flag Day; in August 1949, National Flag Day was established by an Act of Congress.

    Flag Day is not an official federal holiday, though on June 14, 1937, Pennsylvania became the first (and only) U.S. state to celebrate Flag Day as a state holiday, beginning in the town of Rennerdale. Title 36 of the United States Code, Subtitle I, Part A, CHAPTER 1, § 110[2] is the official statute on Flag Day; however, it is at the President's discretion to proclaim officially the observance.
    ...


    Erstellt: 2010-06

  • Holidays in the United States (wikipedia)
  • wikipedia
    Holidays in the United States

    (E?)(L?) http://en.wikipedia.org/wiki/Category:Holidays_in_the_United_States


    (E?)(L?) http://en.wikipedia.org/wiki/Public_holidays_in_the_United_States
    Public holidays in the United States

    Erstellt: 2010-06

  • Flagge der USA
  • Stars and Stripes
  • Star-Spangled Banner
  • Old Glory
  • Flagge der USA
    Stars and Stripes
    Star-Spangled Banner
    Old Glory (W3)

    Die "Flagge der USA" ist geprägt durch 13 Streifen und 50 Sternen. Die 13 Streifen stehen für die ursprünglichen 13 Kolonien, die die USA gründeten. Die 50 Sterne stehen für die heutigen 50 Staaten der USA. Der letzte Staat "Hawaii" wurde im Jahr 1959 aufgenommen. Die aktuelle Flagge ist seit 1960 in Gebrauch.

    Auf Grund der Gestaltung der US-Flagge wird sie auch "Stars and Stripes" (dt. "Sterne und Streifen") genannt. Auf die dominierenden Sterne verweist die Bezeichnung "Star-Spangled Banner" = dt. "Sternenbanner", wörtlich dt. "Sternenübersätes Banner". Die Bezeichnung "Old Glory" = dt. "Alter Ruhm" bringt die zentrale Stellung der US-Flagge zum Ausdruck.

    (E?)(L?) http://en.wikipedia.org/wiki/Category:Flags_of_the_United_States
    (E?)(L?) http://en.wikipedia.org/wiki/Flags_of_the_United_States


    Erstellt: 2010-06

  • Vespa
  • Vespa (W3)

    Ital. "Vespa" = dt. "Wespe" ???

    (E?)(L?) http://www.vespaonline.de/


    Erstellt: 2010-06

  • Transsibirische Eisenbahn
  • Transsibirische Eisenbahn (W3)



    (E?)(L?) http://ru-train.appspot.com/en
    Travel route:
    Moscow | Volga river | Kama river | Perm | Lower Urals, Ust-Kishert settlement | Yekaterinburg | Tyumen | Irtysh river | Clouds over Barabinskaya steppe | Ob river | Novosibirsk | Kia river | Krasnoyarsk | Yenisei river | Zykovo village, a Modern-style water tower | Kan river | Taishet | Irkutsk | Angara river | Baikal lake mirror-like surface | Slyudyanka | Ulan-Ude | Barguzin mountains | Petrovsky plant, Petrovsk-Zabaikalsky city | Kenon lake, Chita city | Tsagan-Khurtei range, Khilok settlement | Karymskoye village, foggy morning | Yerofey Pavlovich | Dawn over the Zeya river | Tom river | Immense Zeisko-Bureinskaya plain | Hingansky reserve | Birobidzhan | Amur river | Khabarovsk | Khekhtsirsky range | Bikin river, cloudy view | Vladivostok | Explore the surroundings

    – the most picturesque places of the route


    Erstellt: 2010-06

  • Fotowettbewerbe (fotowettbewerbe)
  • fotowettbewerbe
    Fotowettbewerbe

    (E?)(L?) http://www.fotowettbewerbe.de/


    Erstellt: 2010-06

  • Fachbücher (paperc)
  • paperc
    Fachbücher

    (E?)(L?) http://paperc.de/


    Erstellt: 2010-06

  • Altgriechisch-Wörterbuch (albertmartin)
  • Griechisch-Wörterbuch, Altgriechisch (albertmartin)
  • albertmartin
    Altgriechisch-Wörterbuch

    (E?)(L?) http://www.albertmartin.de/altgriechisch/


    Erstellt: 2010-06

  • Latein-Wörterbuch (albertmartin)
  • albertmartin
    Latein-Wörterbuch

    (E?)(L?) http://www.albertmartin.de/latein/


    Erstellt: 2010-06

  • Latein-Wörterbuch (frag-caesar)
  • frag-caesar
    Latein-Wörterbuch

    (E?)(L?) http://www.frag-caesar.de/


    Erstellt: 2010-06

  • Latein-Wörterbuch (navigium)
  • navigium
    Latein-Wörterbuch

    (E?)(L?) http://www.navigium.de/suchfunktion.html


    Erstellt: 2010-06

  • Negotiation
  • Negotiation (W3)

    Engl. "negotiation" = "Verhandlung", "Unterhandlung" geht gemeinsam mit dt. "negoziieren" über frz. "négocier", ital. "negoziare" zurück auf lat. "negotiari" = "Handel treiben". Das entsprechende Substantiv ist lat. "negotium" = dt. "Arbeit", "Auftrag", "Geschäft", "Laden", "Mühe", "Not", "politische Betätigung", "Staatsgeschäfte", "Tätigkeit".

    Lat. "negotium" setzt sich zusammen aus lat. "ne-", "neg-", "negare" = dt. "nicht", "verneinen" und lat. "otium" = dt. "Ruhe", "Muße" und bedeutet wörtlich also "Nicht-Muß".

    Erstellt: 2010-06

  • Châteaux de la Loire
  • Schlösser der Loire
  • Châteaux de la Loire
    Schlösser der Loire (W3)

    (E?)(L?) http://www.chateaux-de-la-loire.fr/
    (E?)(L?) http://www.chateaux-de-la-loire.fr/annuaire.htm
    AMBOISE - www.chateau-amboise.com | Angers - www.monuments-nationaux.fr | AZAY-LE-RIDEAU - www.monuments-nationaux.fr | Baugé | Beaugency | Beauregard à Cellettes - www.beauregard-loire.com | BLOIS - www.chateaudeblois.fr | Brézé - www.chateaudebreze.com | Bridoré | Brissac-Quincé | Boumois à St. Martin de la place - www.chateaux-de-la-loire.fr/boumois.htm | Candé à Monts | Challain à Challain-la-Potherie - www.chateauchallain.com | CHAMBORD - www.chambord.org | Chamerolles à Chillieurs aux bois | Champchevrier à Cléré les pins | Chanteloup (Pagode de) Amboise | Châteaudun (Eure-et-Loir) - www.chateauxloire.com/chateaudun.htm | Châteauneuf-sur-Loire (Musée de la marine de Loire) | Chaumont-sur-Loire à Onzain | Chémery | CHENONCEAU - www.chenonceau.com | CHEVERNY - www.chateau-cheverny.com | Chinon - www.forteresse-chinon.fr | Dunois à Beaugency | Durtal | Echarbot à St Sylvain d'Anjou | Faucon Noir (Donjon) à Montbazon | Fontenay à Lignières | Fougères-sur-bièvre - www.monuments-nationaux.fr | Gien (Musée de la chasse) | Gizeux | Gouïn à Tours (Musée archéologique) | Groslot à Orléans (Hôtel Renaissance) | Gué-Péan à Manthou sur Cher | Groye à St Saturnin sur Loire | Jallanges à Vouvray | La Bourdaisière à Montlouis sur Loire | La Bussière (Musée des pêcheurs) | La Chatonnière à Azay-le-Rideau (visite des jardins) - www.lachatonniere.com | La Devinière à Seuilly (Maison natale de Rabelais) | La Farinière à Cinq Mars la Pile | La Ferté St Aubin | La Guerche | Langeais | La Possonnière à Couture sur le Loir (Maison natale de Ronsard) | La Roche Racan à St Paterne Racan | La Seigneurie du Bois à Coudray Macouard | La Thibaudière à Montreuil-Juigné | Le Breuil de Foin à Chigné | Le Clos Lucé à Amboise (Musée Léonard de Vinci) - www.vinci-closluce.com | Le Grand Pressigny (Musée de la préhistoire) | Le Lude (Sarthe) | Le Plessis-Bourré à Ecuillé | Le Plessis-Macé | Les Radrets à Sargé sur Braye | Loches Donjon | Loches Logis Royal - www.chateau-loches.fr | Luynes | Martigné Briand | Marcilly sur Maulne | Mergot à Miré | Meung-sur-Loire | Montbazon | Montgeoffroy à Mazé | Montrichard (Visite extérieure) | Montriou à Feneu (Visite extérieure) | Montreuil Bellay - www.chateau-de-montreuil-bellay.fr | Montpoupon à Céré la Ronde | Montrésor | Montsabert à Coutures | Montsoreau | Moulin à Lassay sur croisne | Nitray à Athée sur cher (Musée) | Pignerolles à St. Barthélémy d'Anjou | Pimpéan à Grézillé | Pont-chevron à Ouzouer sur Trézé | Poirier de Beauvais à Chinon (Musée) | Raguin à Chazé sur Arcos | Réaux (Les) à Chouzé sur Loire | Rivau (du) à Lémeré - www.chateaudurivau.com | Rochambeau à Thoré La Rochette | Rouvray à Chambon | Saché (Demeure de Balzac) | Saint Brisson | Saint jean du Grais à Azay sur Cher | Saumur - Fermé pour travaux, visite extérieure uniquement | Serrain à Durtal | Serrant à Saint Georges sur Loire | Sully-sur-Loire | Talcy - www.monuments-nationaux.fr | Touvois à Maulévrier | Troussay à Cheverny | Ussé à Rigny-Ussé - www.chateaudusse.fr | Valençay (Indre) - www.chateau-valencay.fr | Vallière à Reugny | Valmer à Chancay | Vendôme | VILLANDRY - www.chateauvillandry.com | Villaumaire à Huismes | Villelouet à Chailles | Villeneuve à Martigné-Briand | Villesavin à Tour en Sologne

    (E?)(L1) http://fr.franceguide.com/chateaux-de-la-loire/
    Accueil

    Les 19 châteaux


    (E?)(L?) http://www.france-naturelle.de/loire/radreise-loire.html
    Das Loire-Tal ist eine traumhafte Gegend zum Fahrradfahren. Umso unverständlicher ist es, dass sich der französische Tourismus hierauf noch recht unprofessionell eingestellt hat.

    Ausgeschilderte Fahrradwege gibt es zwar immer häufiger. Doch sind diese Radwege meistens unzureichend markiert, führen häufig über enge, befahrene Verkehrsstraßen und sind nicht selten überfüllt von zahlreichen Fahrradfahrern.
    ...


    (E?)(L?) http://pagesperso-orange.fr/chateauxdelaloire/
    VILLES et CHÂTEAUX
    Amboise | Azay-le-Rideau | Blois | Chambord | Châteaudun | Chaumont | Chenonceau | Cheverny | Chinon | Langeais | Orléans | Tours | Villandry


    (E?)(L?) http://fr.wikipedia.org/wiki/Ch%C3%A2teaux_de_la_Loire
    Parmi les châteaux les plus remarquables et les plus réputés, on peut notamment citer: Sommaire Châteaux situés sur le cours de la Loire
    Château de Mareuil-sur-Cher - Palais ducal de Nevers - Château de Saint-Brisson - Château de Gien - Château de La Bussière - Château de la Verrerie - Château de Sully-sur-Loire - Château de Châteauneuf-sur-Loire - Château de Boisgibault - Château de Meung-sur-Loire - Château de Menars - Château de Talcy - Château de la Ferté - Chambord - Château de Blois - Château de Villesavin - Château de Cheverny - Château de Beauregard - Château de Troussay - Château de Chaumont-sur-Loire - Château d'Amboise - Clos Lucé - Château de Langeais - Château de Gizeux - Château de Montsoreau - Château de Saumur - Château de Boumois - Château de Brissac - Château de Montgeoffroy - Château du Plessis-Bourré


    Erstellt: 2010-06

  • Wortpatenschaft (wortpatenschaft)
  • wortpatenschaft
    Wortpatenschaft

    (E?)(L?) http://www.wortpatenschaft.de/
    (E?)(L?) http://www.wortpatenschaft.de/index.php?cmd=idee
    Lieber Sprachfreund,
    jeder hat ein Lieblingswort: Schenken Sie sich oder jemand anderem eine Patenschaft dafür: welch persönliches Geschenk! Hier erhalten Sie die offizielle Urkunde und den Eintrag in das öffentliche Register. Jedes Wort wird nur einmal vergeben - in Zusammenarbeit mit dem weltgrößten Sprachverein, dem VDS.

    Sie helfen damit, unsere schöne (und etwa 1500 Jahre alte) deutsche Sprache zu schützen: Einen Teil des Ertrags nutzen wir für andere Sprachpflegeprojekte, und durch Ihre Wortvorschläge erweitern wir unsere Datenbank.

    Jeder Pate beschirmt sein Wort, alle Paten die ganze Sprache.


    (E?)(L?) http://www.wortpatenschaft.de/index.php?cmd=fakten
    Fakten über die deutsche Sprache

    (E?)(L?) http://www.wortpatenschaft.de/index.php?cmd=wortliste
    In der Wortliste stöbern

    Erstellt: 2010-06

  • Latin Dictionary and Grammar Aid (Uni Notre Dame)
  • Uni Notre Dame
    Latin Dictionary and Grammar Aid

    (E?)(L?) http://archives.nd.edu/research/dictionary.htm
    (E?)(L?) http://archives.nd.edu/latin.htm


    Erstellt: 2010-06

  • Testberichte (testberichte)
  • Verbraucherinformationen (testberichte)
  • testberichte
    Testberichte
    Verbraucherinformationen

    (E?)(L?) http://www.testberichte.de/


    Erstellt: 2010-06

  • Wortblume (wortblume)
  • Lyrik deutschsprachiger Dichterinnen (wortblume)
  • wortblume
    Wortblume
    Lyrik deutschsprachiger Dichterinnen

    (E?)(L?) http://www.wortblume.de/
    Lyrik vom 17. bis zum frühen 20. Jahrhundert und Kurzbiographie

    Erstellt: 2010-06

  • Werbe-Lexikon (werbeformen)
  • werbeformen
    Werbe-Lexikon

    (E?)(L?) http://www.werbeformen.de/
    (E?)(L?) http://www.werbeformen.de/online-werbung/lexikon.html?no_cache=1
    @ | @facts | Acquisition Rate | Ad | Ad Click | Ad Click Rate | Ad Game | Ad Impression | Ad Server | Advertising Awareness | Advertising Spendings | Advertorial | Affiliate-Marketing | AGIREV | AGOF | AIDA-Modell | Animated GIF | Applikationswerbeformen | B2B (Business-to-Business) | B2C (Business-to-Consumer) | Banner | Bannertausch | Belegungseinheit | Benefitting | Besuch | Besucher | Brand | Brand Awareness | Branding | Burn-Out-Effect | Button | C2B (Consumer-to-Business) | C2C (Consumer-to-Consumer) | Channel | Classifieds | Click Rate | Click Stream | Clicktag-Methode | Clicktracking | Commercial | Content | Content Pages | Conversion Rate | Cookie | Counter | Couponing | CPC (Cost per Click) | CPL (Cost per Lead) | CPM (Cost per Mille) | CPO (Cost per Order) | CPX | CRM (Customer Relationship Management) | Crossmedia | Data Mining | Data Warehouse | Deep Link | DHTML | Direct Ads | Disclaimer | Domain | Dot | Double Opt-in | Download | E-Brand (electronic brand) | E-Business (electronic business) | E-Commerce | E-Mail (electronic mail) | Emercial | Eye Catcher | Fallback Image | FAQ (Frequently Asked Questions) | Fehlstreuung | Firewall | Flash | Flash Intro | Flash Layer | Fliege | Flying Banner | Forum | Frame | Freeware | Frequency Cap | Full Banner | GIF (Graphics Interchange Format) | GIF 89a | GIF oder JPG | Global Village | Googeln | Grafikformate | Header | Hit | HTML Banner | Hypertext | I-Mode | Icon | Image Map | Infotainment | Infotisement | Instant Messenger | Interaktiv | Internet | Interstitial | Intranet | Inventory | IVW (Informationsgemeinschaft zur Feststellung der Verbreitung von Werbeträgern) e.V. | IVW-Verfahren | Java | Javascript | JPEG (Joint Photographic Expert Group) | Junk-Mail | Keyword | Keyword Advertising | Klammeraffe | Klickrate | Konvergenz | Landing Page | Launch | Link | Logfile | M-Commerce | Massenmedium | Media Objects | Medium Rectangle | Messenger | Meta-Tags | Microsite | Mouseover | MP3 | Multiple Link Banner | Multiplikationseffekt | Nanosite | Net | Net Auditing | Net Promotion | Nielsen Gebiete | Offline | One-to-One-Marketing | Online | Online Panel | Opt-in | Option-in-Modell | Option-out-Modell | P2P (Peer-to-Peer) | Page Impressions | PageViews | Permission Marketing | Personalisierung | Pixel | Pop Under | Pop Up | Portal | Pull | Push | Qualitativer TKP (Tausend-Kontakt-Preis) | Quantitativer TKP (Tausend-Kontakt-Preis) | Quicktime | Real Audio | Real Player | Redaktionelle Kooperation | Redirect | Reichweite | Relaunch | Reporting | Rich Media | Rotation | Screenshot | Scroll Ad | Scrollen | Server | Session Length | Shareware | Sichtbereich | Silver Surfer | Site | Site Rotation | Skyscraper | Sniffer Code | Sonderwerbeformen | Spam | Split Screen | Sponsoring | Spot | Standard Skyscraper | Standardwerbeform | Statischer Banner | Stickiness | Sticky Ad | Streaming | Subdomain | Super Banner | Superstitial | Surfen | Target Group | Targeting | Textlink | Thumbnail | TKP (Tausend-Kontakt-Preis) | Traffic | UAP (Universal Ad Package) | Unique User | Universal Flash Layer | URL (Uniform Resource Locator) | Usability | User | User-Tracking | Video on Demand | View Through | View Time | Visit-Dauer | Visitor | Visits | VRML (Virtual Reality Markup Language) | W3C (World Wide Web Consortium) | Wear-Out-Effekt | Web | Webseite | Website | Webtracking | Webwasher | Wide Skyscraper | World Wide Web | XML (Extensible Markup Language) | Zielgruppe

    Erstellt: 2010-06

  • -fell-
  • -fell- (W3)

    In nordenglischen Landschaftsbezeichnungen (wie in "Cross Fell") findet man den Namensbestandteil "-fell-", "fell". Dieser geht zurück auf altnord. "fjell" = "Berg", engl. "mountain".

    Erstellt: 2010-04

  • Wellness
  • Wellness (W3)

    Das dt. "Wellness" kommt natürlich aus England und basiert auf engl. "well" = "gut", "wohl" und bezeichnet einen "Zustand guter Gesundheit, der aktiv angestrebt wird". Die vorwiegend von "Hotels" beworbenen "Wellness"-Angebote sind in der angelsächsischen Welt jedoch - auch sprachlich - weniger verbreitet als in deutschsprachigen Ländern.

    Erstellt: 2010-04

  • Rom (W3)

    Die Stadt "Rom" wurde von den von einer Wölfin gezeugten Zwillingen Romulus und Remus gegründet. Mit zwei Ochsen und einem Pflug zog Romulus eine Markierung um den Palatinhügel, die die Grenze der Stadt bilden sollte. Allerdings konnten sich die Zwillinge nicht über Erstgeburtsrecht und damit die Herrschaft über die neu gegründete Stadt einigen. In dem darüber ausbrechenden Streit wurde Remus erschlagen. Der verbleibende "Romulus" gab der Stadt seinen Namen. Die Gründung soll am 21. April -753 stattgefunden haben. Allerdings sagen die Archäologen, dass von latinischen Hirten und Bauern bereits im -10ten Jh. Rundhütten auf dem Palatin errichtet wurden.

    Erstellt: 2010-04

  • to pencil something in
  • to pencil something in (W3)

    Das Eintragen eines Termins in ein Zeitmanagementsystem nennt man auch im elektronischen Zeitalter noch engl. "to pencil something in" = "vorläufig vormerken". In Zeiten der Terminplanung auf Papier benutzte man einen Bleistift, engl. "pencil", und keinen "Füll(feder)halter", engl. "(fountain" pen", oder "Kugelschreiber", engl. "ball(point) pen", damit man die Einträge bei Terminänderungen wieder leicht ändern konnte.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-04-26


    Erstellt: 2010-04

  • Shopping-Suchmaschine (twenga)
  • twenga
    Shopping-Suchmaschine

    (E?)(L?) http://www.twenga.de/
    (E?)(L?) http://www.presseportal.de/story.htx?nr=1599960
    22.04.2010 | 11:05 Uhr
    Twenga bietet vereinfachten Zugang zu 230 Millionen Online-Angeboten
    Paris, Frankreich (ots) - Die Shopping-Suchmaschine Twenga optimiert ihre Internetseite, um den Zugang zu 230 Millionen Angeboten von 100.000 Online-Shops noch benutzerfreundlicher zu gestalten.
    ...


    Erstellt: 2010-04

  • Veranstaltungskalender (venyoo)
  • venyoo
    Veranstaltungskalender

    (E?)(L?) http://www.venyoo.de/
    (E?)(L?) http://venyoo.de/static/impressum


    (E?)(L?) http://venyoo.de/veranstaltungskalender
    Veranstaltungskalender für...Deutschland Österreich

    Märkte & Feste, Rosengarten Veranstaltungen


    Erstellt: 2010-04

  • IP Address & GeoLocation (findmebyip)
  • findmebyip
    IP Address & GeoLocation

    (E?)(L?) http://www.findmebyip.com/
    Browser | CSS3 | HTML5 | Forms 2.0 | CSS3 Selectors | IP Address & GeoLocation



    Erstellt: 2010-04

  • Etymologie-News (addictomatic)
  • Etymology-News (addictomatic)
  • addictomatic
    Etymologie-News
    Etymology-News

    (E?)(L?) http://www.addictomatic.com/
    Browse the News: Popular | Politics | Gossip | Top News | Thought 2.0 | Food | Offbeat | Gadgets | Web 2.0 | Apple | Games | Entertainment | TV | Movies and DVDs | Music | Shopping | Sports | NFL | NBA | Baseball | Parenting | Business | Fashion | Green

    (E?)(L?) http://addictomatic.com/topic/Etymologie
    (E?)(L?) http://addictomatic.com/topic/Etymology


    Erstellt: 2010-04

  • Castorama
  • Castorama (W3)



    (E?)(L?) http://www.castorama.fr/
    (E?)(L?) http://www.castorama.fr/store/contactUs/includes/qui-sommes-nous-04.jsp
    Historique

    L’enseigne pionnière du bricolage

    Le 13 juin 1969, Castorama crée la 1ère enseigne de bricolage avec le magasin d’Englos, près de Lille. L’idée originale de ce site commercial est de réunir sous un même toit des articles aussi différents que quincaillerie, électricité, bois, droguerie, papier peint et matériaux. Le pari de vendre des produits de professionnels au grand public est ambitieux.

    Aujourd’hui, avec une centaine de points de vente, Castorama détient plus de 20% des parts de marché Grande Surface de Bricolage (GSB) en France.*
    ...


    Erstellt: 2010-05

  • Künstlerporträts der Country-Music (countrymusicnews)
  • countrymusicnews
    Künstlerporträts der Country-Music

    (E?)(L?) http://www.countrymusicnews.de/
    (E?)(L?) http://www.countrymusicnews.de/index.php?option=com_alphacontent&view=alphacontent&Itemid=454


    Erstellt: 2010-06

  • Nachrichten (nachrichten)
  • nachrichten
    Nachrichten

    (E?)(L?) http://www.nachrichten.de/
    (E?)(L?) http://www.nachrichten.de/widget


































    (E?)(L?) http://www.presseportal.de/story.htx?nr=1630619
    14.06.2010
    nachrichten.de startet Web-Widget
    München (ots) - nachrichten.de, das automatisierte Nachrichtenportal, bietet einen neuen Dienst für Website-Betreiber: Mit dem nachrichten.de-Widget lassen sich die News beliebig kombinierbarer Quellen und Themen auf der eigenen Site einbinden.
    ...


    Erstellt: 2010-06

  • aktuell - actual
  • aktuell - actual (W3)

    Das dt. "aktuell" kann unterschiedlich ins Englische übersetzt werden - nicht jedoch als engl. "actual" = dt. "tatsächlich", "eigentlich". Mögliche Übersetzungen für dt. "aktuell" sind engl. "current", "fashionable", "latest", "present", "recent", "topical", "up-to-date".

    Erstellt: 2010-06

  • Infinitiv
  • Infinitiv (W3)

    Der dt. "Infinitiv" (eines Verbs" = dt. "Nennform", geht zurück auf lat. "modus infinitivus" = "nicht näher bestimmt(e Zeitwortform)" und setzt sich zusammen aus lat. "in-" = dt. "un-", "nicht" und lat. "finire" = dt. "beenden". Die Bezeichnung des "Infinitivs" als "Unbeendetes" bezeiht sich auf die "unbestimmte Form des Verbs", ohne Bezug auf Person, Anzahl oder Zeit.

    Erstellt: 2010-03

  • Interjektion
  • Interjektion (W3)

    Die dt. "Interjektion" = dt. "Empfindungswort", "Ausrufewort" (z.B. "ach!", "au!", "hallo!"), geht zurück auf lat. "interiectio" = "das Dazwischenwerfen" und setzt sich zusammen aus lat. "inter" = dt. "zwischen" und lat. "icere" = dt. "legen", "werfen".

    Erstellt: 2010-03

  • Interrogativpronomen
  • Interrogativpronomen (W3)

    Das dt. "Interrogativpronomen" = dt. "Fragefürwort" (welcher, wer, wessen), setzt sich zusammen aus lat. "inter" = dt. "zwischen", lat. "rogare" = dt. "fragen", "bitten", lat. "pro" = dt. "vor" und lat. "nomen" = dt. "Namen".

    Erstellt: 2010-03

  • intransitiv
  • intransitiv (W3)

    Dt. "intransitiv" geht zurück auf lat. "intransitivus" und setzt sich zusammen aus lat. "in-" = dt. "un-", "nicht" und lat. "transire" = dt. "übergehen". Als "intransitiv" bezeichnet man Verben, die nicht zu einem persönlichen Passiv fähig sind. Man kann zwar "geschlagen werden", aber man kann nicht "geschlafen werden", man kann höchstens "schläfrig gemacht werden".

    Erstellt: 2010-03

  • Kardinalzahl
  • Kardinalzahl (W3)

    Die dt. "Kardinalzahl" = dt. "Zahlwort", "Grundzahl", math. "Natürlich Zahl", geht zurück auf lat. "numerus cardinalis" und damit auf lat. "cardinalis" = dt. "Haupt-" und beziehet sich weiter auf lat. "cardo" = dt. "Türangel", Drehpunkt", "Angelpunkt". Es dreht sich also alles um die "Natürlichen Zahlen".

    Auch das dt. "Scharnier" geht über frz. "charnière", und galloromanische Vermittlung zurück auf lat. "cardo" = "Türangel" (gen. lat. "cardinis").

    Erstellt: 2010-03

  • Sieben Weltwunder
  • Sieben Weltwunder (W3)



    (E?)(L?) http://www.parthasverlag.de/de/kulturgeschichte,27,1/
    Debora Barbagli
    Die Sieben Weltwunder der Antike
    Die erste vollständige Liste der bekannten Sieben Weltwunder findet sich in einem Epigramm des phönizischen Schriftstellers Antipatros von Sidon, der einen Reiseführer der antiken Welt schrieb. Dass die Liste in Vorderasien entstand, ist nahe liegend, denn vier der Weltwunder fanden sich dort. Diese Liste wurde im Lauf der Jahre oft geändert und den Reisegewohnheiten der jeweiligen Gesellschaft angepasst. Schon in klassischer Zeit gab es Alternativen wie etwa das Kapitol in Rom, der Hörneraltar der Artemis auf Delos, der Hadrianustempel des Zeus in Kyzikos und viele mehr. So wurden im 13. Jahrhundert die gesamte Stadt Rom, die Hagia Sophia in Konstantinopel und sogar die Arche Noah aufgenommen. So entstand zeitweise ein ganzer Reisekatalog, der alle bedeutenden Bauwerke, Tempel oder Skulpturen enthielt. Doch diese zerfielen mit der Zeit und im Gedächtnis blieb vor allem der Mythos der ursprünglichen Weltwunder, wobei die Stadtmauern Babylons ersetzt wurden durch den Leuchtturm von Pharos.


    Erstellt: 2010-06

  • Not for all the tea in China
  • Not for all the tea in China (W3)

    Engl. "Not for all the tea in China" entspricht dem dt. "Nicht für alles Geld der Welt". Der Ausdruck aus dem 19. Jh. spielt auf die China als bedeutenden Teeproduzent und den hohen Preis des Tees in dieser Zeit an.

    Longjing liegt am Westsee (bei Hangzhou), der sich 2008 um die Aufnahme in die Liste des UNESCO-Weltkulturerbes bewarb.

    (E?)(L?) http:///


    Erstellt: 2010-06

  • Longjing
  • Longjing (W3)

    Die Teesorte "Longjing" ist nach der Herkunftsregion in China "Longjing" benannt.

    Die Bedeutung des Namens der Region (bzw. des Tees) ist engl. "Dragon Well" = dt. "Drachenquelle".

    (E?)(L?) http://english.cri.cn/725/2005/11/29/168@33486.htm
    ...
    Longjing tea was not given its name until the Southern Song Dynasty. Hangzhou as the capital of the country carried out further development in tea production. Knowledge of the tea began to spread and became known all over the country by the times of the Yuan and Ming Dynasties.
    ...


    (E?)(L?) http://english.cri.cn/725/2005/11/29/Zt202@33433.htm
    ...
    "Longjing" ("Dragon Well") Tea is most famous for its unique fragrance and flavor; flat, slender strips of tea leaves in bright green liquid. Longjing tea is grown in the Longjing mountain area of "Hangzhou", southwest of the West Lake. The place has another attraction-China's only tea museum.
    ...


    (E?)(L?) http://www.made-in-china.com/products-search/hot-china-products/Longjing_Tea.html
    Longjing Tea products from various China Longjing Tea manufacturers and Longjing Tea suppliers

    Erstellt: 2010-06

  • Fotos (photocase)
  • photocase
    Fotos

    (E?)(L?) http://www.photocase.com/
    (E?)(L?) http://www.photocase.com/de/photobrowser.asp?m=search&s=Rose


    Erstellt: 2010-06

  • Termine und Jahrestage (tagesvorschau)
  • tagesvorschau
    Termine und Jahrestage
    Termine | Themen | Gedenktage | Jubiläen

    (E?)(L?) http://www.tagesvorschau.de/
    DIARY nn - Termine, Jahrestage, Gedenktage, Geburtstage

    Erstellt: 2010-06

  • Termin-Datenbanken (showprep)
  • showprep
    Termin-Datenbanken

    (E?)(L?) http://www.showprep.de/
    Unser Team sammelt Links, Termine und Themen und stellt dieses Datenmaterial als Recherche-Grundlage für Radio- und Fernsehsendungen zur Verfügung. Wir weisen explizit darauf hin, dass lediglich Datenmaterial zur Verfügung gestellt wird. Es handelt sich nicht um journalistisch aufbereitete Texte. Die von showprep zur Verfügung gestellten Daten bilden lediglich eine Basis für weiter gehende journalistische Recherchen und Vorbereitungen von Radio- und Fernsehsendungen.

    DIARY nn - Termine, Jahrestage, Gedenktage, Geburtstage


    Erstellt: 2010-06

  • ()

  • Landessprachen in Iran:
    Farsi (Persisch), Turksprachen, Kurdisch, Arabisch, Belutschisch u.a. (E?)(L?) http:///


    Erstellt: 2010-06

  • Lima-Syndrom
  • Lima-Syndrom (W3)

    Das "Lima-Syndrom" ist die Umkehr des "Stockholm-Syndroms". Als "Lima-Syndrom" bezeichnet man die Erscheinung, dass Entführer positive Gefühle für die Entführten entwickeln. Benannt ist das "Lima-Syndrom" nach einer Geiselnahme einer Festgesellschaft in der Japanischen Botschaft in Lima am 12.12.1996.

    (E?)(L?) http:///


    Erstellt: 2010-06

  • Stockholm-Syndrom
  • Stockholm-Syndrom (W3)

    Als am 23.08.1973 zwei Männer eine Bank in "Stockholm" überfielen ahnten sie nicht, dass die Geburt eines neuen Begriffs einleiteten. Die vier Geisel, die Sie nahmen, zeigten nach ihrer Befreiung den Geiselnehmern gegenüber eine große Dankbarkeit. Dies war nicht nur dem Überleben geschuldt. Die Geisel hatten während der Aktion eine emotionale Beziehung zu den Geiselnehmern aufgebaut, die noch danach anhielt. Die Geisel ergriffen der Polizei gegenüber Partei für die Geiselnehmer, besuchten sie in der darauf folgenden Haft und eine Geisel verlobte sich mit einem Geiselnehmer.

    (E?)(L?) http://www.stockholmsyndrom.com/


    Erstellt: 2010-06

  • Color schemes generator (colorschemedesigner)
  • colorschemedesigner
    Color schemes generator

    (E?)(L?) http://www.colorschemedesigner.com/


    Erstellt: 2010-06

  • Kindergarten
  • Kindergarten (W3)

    Der erste Kindergarten wurde im Jahr 1840 von ??? Fröbel gegründet. Mit seiner Wortschöpfung wollte er zum Ausdruck bringen, daß Kinder wie in einem Garten wachsen sollen. Konkret wurde dies veranschaulicht durch reale Gärten, in denen den Kindern die Natur näher gebracht werden sollte.

    (E?)(L?) http:///


    Erstellt: 2010-06

  • Les Mads - Mode, Fashion, Couture, Beauty, Style, Musik, Party (lesmads)
  • lesmads
    Les Mads - Mode, Fashion, Couture, Beauty, Style, Musik, Party

    (E?)(L?) http://www.lesmads.de/


    Erstellt: 2010-06

  • Dokumentarfilme (dokumentarfilm24)
  • dokumentarfilm24
    Dokumentarfilme

    (E?)(L?) http://www.dokumentarfilm24.de/


    Erstellt: 2010-06

  • Songtexte (wikia)
  • wikia
    Songtexte

    (E?)(L?) http://lyrics.wikia.com/


    Erstellt: 2010-06

  • Wanderbares Deutschland (wanderbares-deutschland)
  • wanderbares-deutschland
    Wanderbares Deutschland

    (E?)(L?) http://www.wanderbares-deutschland.de/


    Erstellt: 2010-06

  • Berliner Strassennamen erklärt (berliner-stadtplan)
  • berliner-stadtplan
    Berliner Strassennamen erklärt

    (E?)(L?) http://www.berliner-stadtplan.com/
    Nicht zu allen, aber zu vielen Strassennamen Berlins findet man Hinweise zur Namensgebung.

    (E?)(L?) http://www.berliner-stadtplan.com/poi/
    1618 Herberge Berlin 17. Juni 1st Creatif Hotel Elephant 25hours Hotel A&O Berlin am Zoo A&O Berlin Friedrichshain A&O Berlin Mitte A&O Dresden Hauptbahnhof A&O Hamburg Hammer Kirche A&O Hamburg Hauptbahnhof A&O Hamburg Reeperbahn A&O München Hauptbahnhof A1-Hotel-Hamburg A100 Autobahn A105, Berlin-Reinickendorf ABACUS Tierpark Hotel Abbestraße, Berlin-Charlottenburg Abguss-Sammlung Antiker Plastik Abion Spreebogen Waterside Hotel ABION Villa Suites Abram-Joffe-Straße, Berlin-Adlershof Abteibrücke Academy Hotel ACHAT Comfort Hotel Dresden Altstadt Ackerstraße Ackerstraße, Berlin-Mitte Ackerstraße, Berlin-Wedding Ackselhaus Adalbertstraße, 10179 Berlin-Mitte Adalbertstraße, 10997 Berlin-Kreuzberg Adalbertstraße, 10999 Berlin-Kreuzberg Adam-Kuckhoff-Platz, Kleinmachnow Adele Designhotel Adele-Schreiber-Krieger-Straße, Berlin-Mitte Adina Apartment Hotel Berlin Checkpoint Charlie Admiralbrücke Adolf-Grimme-Ring, Kleinmachnow Adolfstraße, Berlin-Wedding Adrema Hotel Affenclub Afrikanische Straße, Berlin-Wedding AGON Aldea Hotel AGON am Alexanderplatz Agricolastraße, Berlin-Moabit Ägypten AHA Hotel Ahlbecker Straße, Berlin-Prenzlauer Berg Ahorn Hotel & Restaurant Ahornhof, Kleinmachnow Ahornweg, Berlin-Friedrichshagen AI Königshof Air in Berlin Airporthotel Berlin-Adlershof Akademie der Künste Akademie der Künste Akademie-Hotel Berlin Akzent Hotel am Forum Steglitz alameda berlin Albergo Hotel Berlin Albert’s Albrecht Haushofer Albrecht von Graefe Albrechts Teerofenweg, Berlin-Wannsee Albrechtshof Albrechtstraße, Berlin-Mitte Alecsa Hotel am Olympiastadion Alemannenallee, Berlin-Westend Alemannenstraße, Berlin-Frohnau aletto Jugendhotel aletto Jugendhotel Kreuzberg Alex Hotel Alexanderplatz, Berlin-Mitte Alexanderufer, Berlin-Mitte ALFA Hotel Alfred-Kowalke-Straße, Berlin-Friedrichsfelde Alice-Berend-Straße, Berlin-Moabit Alice-Salomon-Park Alice-und-Hella-Hirsch-Ring, Berlin-Rummelsburg Alitania Apartments Potsdamer Platz All In Hostel Berlin Allee Am Forsthaus, Kleinmachnow Allendorfer Weg, Berlin-Alt-Hohenschönhausen AlliiertenMuseum Alma Schlosshotel im Grunewald Almutstraße, Berlin-Hermsdorf Alsenbrücke Alster Hof Alsterappartements Hamburg Alsterhof Hotel Berlin Alt Moabit Alt Schmöckwitz Alt-Hermsdorf, Berlin-Hermsdorf Alt-Köpenick, Berlin-Köpenick Alt-Lietzow, Berlin-Charlottenburg Alt-Mariendorf, Berlin-Mariendorf Alt-Marzahn, Berlin-Marzahn Alt-Moabit, Berlin-Moabit Alt-Reinickendorf, Berlin-Reinickendorf Alt-Tegel, Berlin-Tegel Altan Hotel Alte Autobahntrasse ALTE CITY at Memory Church Alte Dorfkirche Alte Fahlenbergbrücke Alte Jakobstraße, Berlin-Kreuzberg Alte Jakobstraße, Berlin-Mitte Alte Kaulsdorfer Straße, Berlin-Köpenick Alte Leipziger Straße, Berlin-Mitte Alte Nationalgalerie Alte Nazarethkirche Alte Nicolaischule Alte Pfarrkirche Alte Pfarrkirche Lichtenberg Alte Potsdamer Landstraße Alte Potsdamer Straße, Berlin-Tiergarten Alte Spree Alter Berlin-Spandauer Schifffahrtskanal Alter Johannisfriedhof Alter Markt, Berlin-Köpenick Alter See Alter Spreearm Altes Konservatorium Altes Museum Altes Rathaus Altes Zollhaus Altmarkstraße, Berlin-Steglitz Altona Altonaer Straße, Berlin-Hansaviertel Altstadt Hotel Altstadt-Pension-Potsdam Am Ausblick, Berlin-Frohnau Am Bahnhof Spandau, Berlin-Spandau Am Bauersee, Berlin-Müggelheim Am Borsigturm, Berlin-Tegel Am Eichenhain, Berlin-Frohnau Am Festungsgraben, Berlin-Mitte Am Fließ Am Fort, Berlin-Spandau Am Friedrichshain, Berlin-Prenzlauer Berg Am Großen Wannsee Am Großen Wannsee, Berlin-Wannsee Am Grünen Hof, Berlin-Frohnau Am Heckerdamm Am Hochwald, Kleinmachnow Am Jartz, Berlin-Lübbars Am Katharinenholz Am Kleinen Wannsee, Berlin-Wannsee Am Krusenick, Berlin-Köpenick Am Kupfergraben, Berlin-Mitte Am Kurfürstendamm Am Küstengarten, Berlin-Rahnsdorf Am Langen See Am Luisenbad Am Lustgarten, Berlin-Mitte Am Mooskissen, Kleinmachnow Am Mühlenfließ, Berlin-Rahnsdorf Am Nordhafen, Berlin-Wedding Am Nußbaum, Berlin-Mitte Am Oberbaum, Berlin-Friedrichshain-Kreuzberg, Berlin-Friedrichshain Am Ortsrand, Berlin-Gatow Am Pankepark, Berlin-Mitte Am Park, Berlin-Tiergarten Am Pferdegatter, Kleinmachnow Am Rodelberg, Kleinmachnow Am Rohrbusch, Berlin-Lübars Am Sandkrug, Glienicke Nordbahn Am Sandwerder, Berlin-Wannsee Am Schäfersee, Berlin-Reinickendorf Am Schonungsberg, Berlin-Rahnsdorf Am Schweizer Garten, Berlin-Prenzlauer Berg Am Sendlinger Tor Am Spreebord, Berlin-Charlottenburg Am Tegeler Hafen, Berlin-Tegel Am Tierpark, Berlin-Friedrichsfelde Am Treptower Park Am Vierling, Berlin-Zehlendorf Am Vierrutenberg, Berlin-Lübars Am Waldrand, Potsdam-Klein Glienicke Am Wall, Kleinmachnow Am Wasserbogen, Berlin-Spandau Am Weidendamm Am Zirkus, Berlin-Mitte Amadeo Hotel-garni AMADEUS am Kurfürstendamm Amadeus Hostel Berlin Amary City Residence Amaryl City Hotel AMBASSADOR Hotel Babelsberg Ambassador Parkhotel Ambient Hotel Colina Ameisengasse, Kleinmachnow Amrumer Straße, Berlin-Wedding Amstel House Hostel Amtsgericht Schöneberg Amtsgericht Wedding An den Freiheitswiesen, Berlin-Spandau An den Knabenhäusern, Berlin-Rummelsburg An den Treptowers, Berlin-Alt-Treptow An der Bucht, Berlin-Rummelsburg An der Koppel, Kleinmachnow An der Mühle An der Mühle, Berlin-Tegel An der Priesterkoppel, Berlin-Rosenthal An der Putlitzbrücke, Berlin-Tiergarten An der Wasserstadt, Berlin-Spandau An der Wuhlheide Andersen Hotel Birkenwerder ANDOR Hotel Europa ANDOR Hotel Plaza Andreaskirche Angleterre Hotel Anhalter Steg Anklamer Straße, Berlin-Mitte anna hotel Anna-Louisa-Karsch-Straße, Berlin-Mitte Annas Ferienhaus Anno 1900 Hotel Babelsberg Ansgarstraße, Berlin-Frohnau Antikhotel am Völkerschlachtdenkmal Antikriegsmuseum Antonplatz, Berlin-Weißensee AO Aparion Apartmenthaus Leipzig APAROTEL Berlin Apart Hotel Ferdinand Berlin Apart Hotel Taucha Apart HOTEL VIVALDI Apart PENSION BABELSBERG APARTCity Serviced Apartments Aparthotel Binzer Sterne Aparthotel Neumarkt ApartHotel Residenz am Deutschen Theater Aparthotel VEGA Aparthotels An der Frauenkirche Apartment Absolut Apartment Berlin Apartment Hotel Landhaus Lichterfelde Apartment nahe Kurfürstendamm Apartment Residenz 2000 Berlin Apartment Schulz Apartment- und Zimmervermietung am Park Apartment-Hotel Hamburg Hamm Apartment-Hotel-Dahlem Apartmentconcept Apartmenthaus am Potsdamer Platz Apartmenthaus Hamburg (Nichtraucher-Hotel) Apartmenthaus Kibar Apartmenthaus Sybille Hecke Apartmenthaus Tegel Apartmenthotel Kaiser Friedrich Apartmenthouse Stay Munich Apartments am Brandenburger Tor Apartments Berlin City West Apartments Checkpoint Charlie Apartments CONZEPTplus Apartments Dresden Apartments im Golden Tulip Berlin - Hotel Hamburg Apartments im Szenebezirk von Prenzlauer Berg Apartments im Zentrum Berlin Apostel-Paulus-Kirche Apostolische Nuntiatur Appart-Hotel-Heldt Appartementhaus ’Blaues Palais’ Appartementhaus ’Kleines Palais’ Appartementhotel Hamburg Aquaris ARAGON am Lenné-Park Arcadia Belmondo Hamburg ARCOTEL Rubin Arcotel Velvet Arendsweg, Berlin-Alt-Hohenschönhausen Argentinische Allee, Berlin-Dahlem Arkonaplatz, Berlin-Mitte ARKTUR City Hotel Armbrustweg, Berlin-Reinickendorf Arminius-Markthalle Arminiusstraße, Berlin-Moabit Armony Hotel & Business Center Art Hotel Charlottenburger Hof Berlin Art Nouveau Hotel Arta Lenz Hotel Arte Luise Kunsthotel Artemisia Berlin Frauenhotel artepuri hotel meerSinn - "Lust auf gesunden Urlaub" ArtHotel Connection Artis Suite Hotel Artuswall, Berlin-Frohnau art´otel Leipzig City Center art’ appart Suiten art’appart im Kempinski Plaza art’otel berlin city center west by park plaza art’otel berlin kudamm by park plaza art’otel berlin mitte by park plaza art’otel dresden by park plaza art’otel potsdam Ärztehaus Astrid am Kurfürstendamm Atlanta am Kurfürstendamm Atlanta Boardinghouse Leipzig Atlanta Hotel Central Atlanta Hotel International Leipzig August Herrmann August-Bebel-Platz, Kleinmachnow Auguste-Hauschner-Straße, Berlin-Tiergarten Augustenburger Platz, Berlin-Wedding Augustusplatz Aurora Aurora Hostel Aussen Alster Hotel Aussichtsturm Auswärtiges Amt Auto-Parkhotel Autobahnbrücke Autoreisezug avendi Hotel am Griebnitzsee Avus, Berlin-Grunewald AZIMUT Hotel Berlin Kurfürstendamm

    (E?)(L?) http://www.berliner-stadtplan.com/poi/?navi=16&src=berlin&cat=all
    B! Apartments ...

    (E?)(L?) http:///
    C

    (E?)(L?) http:///
    D

    (E?)(L?) http:///
    E

    (E?)(L?) http:///
    F

    (E?)(L?) http:///
    G

    (E?)(L?) http:///
    H

    (E?)(L?) http:///
    I

    (E?)(L?) http:///
    J

    (E?)(L?) http:///
    K

    (E?)(L?) http://www.berliner-stadtplan.com/poi/?chr=l&src=berlin&cat=all
    L

    (E?)(L?) http:///
    M

    (E?)(L?) http:///
    N

    (E?)(L?) http:///
    O

    (E?)(L?) http:///
    P

    (E?)(L?) http:///
    Q

    (E?)(L?) http:///
    R

    (E?)(L?) http:///
    S

    (E?)(L?) http:///
    T

    (E?)(L?) http:///
    U

    (E?)(L?) http:///
    V

    (E?)(L?) http:///
    W

    (E?)(L?) http:///
    X

    (E?)(L?) http:///
    Y

    (E?)(L?) http:///
    Z

    Erstellt: 2010-06

  • ()

  • (E?)(L?) http://www.zeit.de/wissen/zeit-geschichte/index
    (E?)(L?) http://www.zeit.de/themen/serie/index?q=zeitlaeufte
    Serie: "Zeitläufte"

    Erstellt: 2010-06

  • Weltfussball (weltfussball)
  • weltfussball
    Weltfussball

    (E?)(L?) http://www.weltfussball.de/
    Sprüche, Fussballer des Jahres, Videobeiträge, ...

    Erstellt: 2010-06

  • Soundeffekte für die Homepage (soundjay)
  • soundjay
    Soundeffekte für die Homepage

    (E?)(L?) http://www.soundjay.com/


    Erstellt: 2010-06

  • Website-Empfehlungen (pixelgangster)
  • pixelgangster
    Website-Empfehlungen

    (E?)(L?) http://www.pixelgangster.de/


    Erstellt: 2010-06

  • Stilmagazin für Gentlemen (stilmagazin)
  • stilmagazin
    Stilmagazin für Gentlemen

    (E?)(L?) http://www.stilmagazin.com/


    Erstellt: 2010-06

  • Icons (iconload)
  • iconload
    Icons

    (E?)(L?) http://www.iconload.de/


    Erstellt: 2010-06

  • Nutzloses Produktdesign (jimdo)
  • jimdo
    Nutzloses Produktdesign

    (E?)(L?) http://oopsaward.jimdo.com/


    Erstellt: 2010-06

  • Osteuropa-Informationen (maiak)
  • maiak
    Osteuropa-Informationen

    (E?)(L?) http://www.maiak.info/


    Erstellt: 2010-06

  • ()

  • (E?)(L?) http://www.unmoralische.de/
    Moral ist egal Auch wenn Markus Gansels unmoralische Webseite ihrem Namen eigentlich gar nicht gerecht wird und überdies schon zwei Jahren auf neue Inhalte wartet, lohnt sich ein Blick auf das WWW-Urgestein immer wieder aufs Neue. Denn dort trifft den arglosen Surfer der optisch eher dürftigen Webseite ein inhaltliches Panoptikum, dessen Spektrum man allenfalls in kleinen Auszügen aufzählen kann. Neben unzähligen Zitaten und Aphorismen beschäftigt sich der Autor unter anderem mit kuriosen Irrtümern, bizarren Gesetzen, unglaublichen Zufällen, skurrilen Begebenheiten und 25 Dingen, die man bei Sex nicht sagen sollte. Wenn Sie also mal ein paar Minuten, Stunden, Tage übrig haben... : gp/jeb

    Erstellt: 2010-06

  • Assure vs. Ensure vs. Insure (W3)



    (E?)(L?) http://www.grammarbook.com/homonyms/confusing-words-1.asp
    Assure, ensure, and insure can be confusing. Here are the definitions along with some examples to help clarify the distinctions for you. Assure: to promise or say with confidence Example: Let me assure you that I will be at the meeting at noon. Ensure: to make sure something will/won’t happen Example: To ensure my family’s safety, I have installed an alarm system. Insure: to issue an insurance policy Example: I will insure my home with additional fire and flood policies.

    Erstellt: 2010-06

  • Douane
  • Douane (W3)



    (E?)(L?) http://www.douane.gouv.fr/menu.asp?id=459
    Connaître la douane | La douane et l'Histoire
    La douane et l'Histoire
    De l'Antiquité à la douane moderne, suivez les évolutions des missions de la douane, découvrez la riche histoire de la lutte entre douaniers et fraudeurs.


    Erstellt: 2010-06

  • (W3)



    (E?)(L?) http://www.site-du-jour.com/dossiers/histoire-jardins.html
    Histoire des jardins

    Le premier jardin connu du monde, et cité dans la Bible, n'avait d'autre créateur que Dieu lui-même. Or c'est dans ce lieu mythique que le Créateur engendre les deux premiers jardiniers : Adam et Ève. Ce lieu merveilleux, illustré entre autres par le pinceau génial d'Hieronymus Bosch (v.1453-v.1516) dans sa composition Le Jardin des Délices, vers 1504, devient aux yeux des fidèles le Paradis terrestre. Le jardin, dès son origine, inspire le beau, le merveilleux, la quiétude, le bonheur… Mais aussi la puissance, la magnificence du pouvoir !
    ...


    Erstellt: 2010-06

  • Histoire de la littérature française (lecteurscompulsifs)
  • lecteurscompulsifs
    Histoire de la littérature française



    (E?)(L?) http://www.lecteurscompulsifs.com/category/histoire-de-la-litterature-francaise/
    Archives de la catégorie "Histoire de la littérature française"

    Erstellt: 2010-06

  • ()



  • (E?)(L?) http://www2.ville.montreal.qc.ca/archives/portraits/fr/
    Introduction
    Passionné d’histoire, et plus spécifiquement d’histoire canadienne, Aegidius Fauteux consacre temps et énergie à la recherche, colligeant ainsi une quantité impressionnante d’informations historiques, biographiques, généalogiques et bibliographiques. Son fonds d’archives, conservé par la Section des archives de la Direction du greffe de la Ville de Montréal depuis 1997, et auparavant par la Bibliothèque de Montréal1, témoigne éloquemment de ce travail minutieux et représente un fonds d’une immense richesse documentaire.
    ...



    Erstellt: 2010-06

  • kausal
  • kausal (W3)

    Dt. "kausal" = "begründend" geht zurück auf lat. "causalis", lat. "causa" = dt. "Grund", "Ursache", "Sache".

    Erstellt: 2010-03

  • Komparativ
  • Komparativ (W3)

    Dt. "Komparativ" = dt. "1. Steigerungsstufe" (Bsp. "besser"), geht zurück auf lat. "gradus comparativus" = dt. "zum Vergleichen geeignet" und setz sich zusammen aus lat. "con-", "com-" = dt. "mit" und lat. "para-", griech. "pará" = "neben", "entlang".

    Erstellt: 2010-03

  • konditional
  • konditional (W3)

    Dt. "konditional" = dt. "bedingend" geht zurück auf lat. "condicionalis" = dt. "bedingungsweise angenommen", und setzt sich zusammen aus lat. "con-" = dt. "mit" und lat. "dicere" = dt. "sagen", "reden" (wörtlich "mit dem Gesagten", "das Gesagte vorausgesetzt").

    Erstellt: 2010-03

  • Konjunktion
  • Konjunktion (W3)

    Dt. "Konjunktion" = dt. "Bindewort" (Bsp.: und, oder, aber, dass, ...), geht zurück auf lat. "coniunctio" = "Verbindung", "Bindewort", und setzt sich zusammen aus lat. "con-" = dt. "mit" und lat. "iunctura" = dt. "Verbindung", "Gelenk", Vereinigung", "Verknüpfung".

    Erstellt: 2010-03

  • Konjunktiv
  • Konjunktiv (W3)

    Dt. "Konjunktiv" = dt. "Möglichkeitsform" geht zurück auf lat. "modus coniunctivus" = dt. "verbindender Modus", und setzt sich zusammen aus lat. "con-" = dt. "mit" und lat. "iunctura" = dt. "Verbindung", "Gelenk", Vereinigung", "Verknüpfung". Eine konjunktive Aussage stellt eine Verbindung zwischen einer Annahme und einer (möglichen) Folge her: "wenn ich ein Beispiel fände, wäre es klarer".

    Erstellt: 2010-03

  • Konkretum
  • Konkretum (W3)

    Dt. "Konkretum" = dt. "etwas Gegenständliches", geht zurück auf lat. "concretus", "concrescere" = "zusammenwachsen", und setzt sich zusammen aus lat. "con-" = dt. "mit" und ide. Wurzel "*ker-" = "wachsen" (vgl. engl. "grow" und engl. "concrete" = "Beton", wörtlich "das Zusammenwachsende").

    Erstellt: 2010-03

  • konsekutiv
  • konsekutiv (W3)

    Dt. "konsekutiv" = dt. "folgernd" geht zurück auf lat. "consecutio" = "Folge", "Wirkung", lat. "consequi" = dt. "konsequent", und setzt sich zusammen aus lat. "con-" = dt. "mit" und lat. "sequi" = dt. "folgen".

    Erstellt: 2010-03

  • konzessiv
  • konzessiv (W3)

    Dt. "konzessiv" = dt. "einräumend", "behindernd" (nicht verhindernd), geht zurück auf lat. "concedere" = dt. "konzedieren", "zugeben", wörtlich "mitgehen", "beiseite treten", und setzt sich zusammen aus lat. "con-" = dt. "mit" und lat. "cedere" = dt. "gehen".

    Erstellt: 2010-03

  • Korrelat
  • Korrelat (W3)

    Dt. "Korrelat" = dt. "Wort, das grammatikalisch oder bedeutungsmäßig auf ein anderes Wort bezogen ist", wörtlich "das Mitgebrachte", (Bsp.: "vieles, was", "derselbe, welcher") geht zurück auf lat. "correlatio" = "Wechselbeziehung", und setzt sich zusammen aus lat. "kor" = dt. "zusammen", "mit" und lat. "relatum" (2. Part. von lat. "referre") = dt. "zurückführen", "zurückwenden" (lat. "ferre" = dt. "tragen", "bringen") (vgl. auch "Christoph(erus) = "Christusträger", "Phosphor" = "Lichtträger", "Amphore" = "Ambiphore" = "Gegenträger" (Behälter mit zwei Griffen"), "Euphorie" = "gutes Tragen").

    Erstellt: 2010-03

  • lokal
  • lokal (W3)

    Dt. "lokal" = "räumlich" geht zurück auf lat. "locus" = "Ort", "Platz", "Stelle".

    Erstellt: 2010-03

  • modal
  • modal (W3)

    Dt. "modal" = dt. "die Art und Weise kennzeichnend" geht zurück auf lat. "modus" = "Maß", "Art", "Weise".

    Erstellt: 2010-03

  • Nominativ
  • Nominativ (W3)

    Dt. "Nominativ" = dt. "Werfall", wörtlich "das Namentliche" geht zurück auf lat. "casus nominativus" = "zur Nennung gehörender Fall", lat. "nomen" = "Name".

    Erstellt: 2010-03

  • Objekt
  • Objekt (W3)

    Dt. "Objekt" (Genitivobjekt, "Dativobjekt", "Akkusativobjekt", "Präpositionalobjekt") = dt. "Satzglied, das von einem Verb als Ergänzung gefordert wird", geht zurück auf lat. "obicere" = "entgegenwerfen", "vorsetzen", und setzt sich zusammen aus lat. "-ob-", "-of-", "-ok-", "-op-" = "gegen", "wegen", "nach" und lat. "icere", "iacere" = dt. "legen", "werfen".

    Erstellt: 2010-03

  • Ordinalzahl
  • Ordinalzahl (W3)

    Dt. "Ordinalzahl" = dt. "Ordnungszahl" geht zurück auf lat. "ordinarius" = "ordentlich". lat. "ordo" (Gen. "ordinis") = dt. "Reihe", "Serie".

    Erstellt: 2010-03

  • Partikel
  • Partikel (W3)

    Dt. "Partikel" = dt. "Wort, das nicht gebeugt werden kann" (Bsp.: Adverb, Präposition, Konjunktion), geht zurück auf lat. "particula" = dt. "Teilchen".

    Erstellt: 2010-03

  • Partizip
  • Partizip (W3)

    Dt. "Partizip" = dt. "Form des Verbs, die eine Mittelstellung zwischen Verb und Adjektiv einnimmt", "Mittelwort" ("Partizip Präsens", "Mittelwort der Gegenwart", Bsp.: "der lobende Lehrer"), ("Partizip Perfekt", "Mittelwort der Vergangenheit", Bsp.: "der gelobte Schüler"), geht zurück auf lat. "participium", lat. "particeps" = dt. "teilhabend", und setzt sich zusammen aus lat. "partis" = dt. "Anteil" und lat. "cippus" = dt. "Pfahl" ???.

    Erstellt: 2010-03

  • TV-Programmbegleiter (tvister)
  • tvister
    TV-Programmbegleiter

    (E?)(L?) http://www.tvister.de/


    Erstellt: 2010-06

  • Massage
  • Massage (W3)



    (E?)(L?) http://www.massage-netzwerk.de/
    Infos für Praktiker und Klienten

    Erstellt: 2010-06

  • (typetester)
  • typetester

    (E?)(L?) http://www.typetester.org/
    Verschiedene Schriften miteinander vergleichen

    Erstellt: 2010-06

  • Paris in 2000 Fotos (paris-26-gigapixels)
  • paris-26-gigapixels
    Paris in 2000 Fotos

    (E?)(L?) http://www.paris-26-gigapixels.com/


    Erstellt: 2010-06

  • Le Dico critique du Web (mynetwords)
  • mynetwords
    Le Dico critique du Web

    (E?)(L?) http://www.mynetwords.com/
    (E?)(L?) http://www.mynetwords.com/Un-dico-pourquoi
    Pourquoi un dico critique ?

    Si les termes "Google bombing", "Blogoler", "Twitter", "Crowdsourcing", "Mash up", "Poker", "Statut" vous sont familiers, surtout passez votre chemin. Sinon suivez le guide « myNetwords, le dico critique du web ».

    Ce dico a été conçu dans le but d’éclairer les néophytes qui se décident à rejoindre un Réseau social sur le web (Facebook, Linkedin, Twitter…), qui veulent blogger ou micro blogger, participer à des forums ou plus simplement comprendre ce qui est en train de se passer avec l’explosion des échanges de messages, photos, vidéos sur le web.

    C’est pas facile. On compte plus d’une centaine de mots couramment utilisés par ceux qui utilisent les réseaux sociaux virtuels, surfent sur les blogs, les sites…et qui n’ont pas (encore) leur place dans les dictionnaires mais qui contaminent déjà notre langage parlé, en tout cas le langage « branché » : Dweet, Googler ou Poker quelqu’un, Geek, Application, Web 2.0…

    myNetwords donne un sens à tous ces mots tendance et permet aussi de se faire une opinion de la réalité qui est derrière chacun de ses mots, savoir s’il faut en en sourire, en rire, les prendre au sérieux ou en avoir peur.

    Pour l’instant, il réunit une centaine de mots clefs, mais il sera complété dans le temps notamment grâce aux commentaires des internautes.


    (E?)(L?) http://www.mynetwords.com/A


    (E?)(L?) http://www.mynetwords.com/B
    ...

    Erstellt: 2010-06

  • We love Words (welovewords)
  • welovewords
    We love Words

    (E?)(L?) http://www.welovewords.com/
    (E?)(L?) http://www.welovewords.com/requests


    Erstellt: 2010-06

  • Musikstücke finden (trouvwetamusique)
  • trouvwetamusique
    Musikstücke finden

    (E?)(L?) http://www.trouvwetamusique.fr/


    Erstellt: 2010-06

  • Flugbewegungen in DE (quadrant-atc)
  • quadrant-atc
    Flugbewegungen in DE

    (E?)(L?) http://www.quadrant-atc.net/ads.htm.de


    Erstellt: 2010-06

  • Flug-Kürzel (flightstats)
  • flightstats
    Flug-Kürzel

    (E?)(L?) http://www.flightstats.com/


    Erstellt: 2010-06

  • Flugfunk legal (liveatc)
  • liveatc
    Flugfunk legal

    (E?)(L?) http://www.liveatc.net/


    Erstellt: 2010-06

  • Fiji offiziell (fijime)
  • fijime
    Fiji offiziell

    (E?)(L?) http://www.fijime.com/


    Erstellt: 2010-06

  • Bär
  • Bär (W3)

    Dt. "Bär"

    (E?)(L?) http://www.ms-net.ch/baeren.htm


    Erstellt: 2010-06

  • Bear
  • Bear (W3)

    Engl. "Bear"

    (E?)(L?) http://www.bearbiology.com/
    Bären-Schutzgemeinschaft IBA

    (E?)(L?) http://www.bearplanet.org/


    Erstellt: 2010-06

  • Bookshop - All the EU publications (europa)
  • EU publications (europa)
  • europa
    Bookshop
    All the EU publications YOU are looking for!

    (E?)(L?) http://www.bookshop.europa.eu/
    Themes:

    Managed by the Publications Office of the European Union, EU Bookshop gives you online access to the European Union’s official publications.

    You can download them as PDF files or (for some) order copies to be sent to you at home.


    Erstellt: 2010-06

  • Alltagshilfen (frag-mutti)
  • DAS Nachschlagewerk für Junggesellen (frag-mutti)
  • frag-mutti
    Alltagshilfen
    DAS Nachschlagewerk für Junggesellen

    (E?)(L?) http://www.frag-mutti.de/


    Erstellt: 2010-06

  • Alltagshilfen (frag-vati)
  • frag-vati
    Alltagshilfen

    (E?)(L?) http://www.frag-vati.de/


    Erstellt: 2010-06

  • Passwort
  • Passwort (W3)



    (E?)(L?) http://www.secorvo.de/publikationen/passwortsicherheit-fox-schaefer-2009.pdf
    Dirk Fox, Frank Schaefer
    Passwörter – fünf Mythen und fünf Versäumnisse

    Bis heute wird der Zugriff auf Daten und Anwendungen überwiegend durch einen Passwortschutz kontrolliert. Oft ist dieser Passwortschutz jedoch unzureichend, weil sich für die Gestaltung von und den Umgang mit Passworten hartnäckig unrichtige Überzeugungen halten und die falschen Prioritäten gesetzt werden.
    ...


    Erstellt: 2010-06

  • Birkenporzellanspinner
  • Birkenporzellanspinner (W3)



    (E?)(L?) http://www.bloobook.net/browse/lepidoptera.php?lg=


    (E4)(L1) http://www.insektenbox.de/regideu.htm
    Birken-Porzellanspinner

    Erstellt: 2010-07

  • Pappelporzellanspinner
  • Pappelporzellanspinner (W3)



    (E?)(L?) http://www.bloobook.net/browse/lepidoptera.php?lg=


    (E4)(L1) http://www.insektenbox.de/regideu.htm
    Pappel-Porzellanspinner

    Erstellt: 2010-07

  • Porzellannotmünzen
  • Porzellannotmünzen (W3)

    Die "Porzellannotmünzen"

    (E1)(L1) http://www.reppa.de/lexikon/
    (E3)(L1) http://www.anumis.de/lexikon/p.html


    Erstellt: 2010-07

  • Porzellanschnecke
  • Porzellanschnecke (W3)



    Porzellan-Schnecke (W3)

    Adelung schreibt zur "Porzellan-Schnecke":

    plur. die -n, eine Art gewundener einfächeriger Schnecken, welche eyrund sind, und in der Mitte eine mit Zähnen versehene Öffnung haben; "Porcellana", "Concha Cyprea", "Venerea", "Etythraea", weil die Öffnung einige Ähnlichkeit mit den weiblichen Geburtstheilen hat, wovon auch der Nahme "Porcellana" herrühren soll, wenn anders derselbe nicht eine Öffnung überhaupt bedeutet, (S. Pforte.) Im Deutschen wird sie auch "Porzellan Muschel", und, wenn sie verkleinert gefunden wird, "Porzellanit" genannt. Die Holländer heißen sie "Klipkousse", "Kliphoorn". Von ihr soll das "Porzellan" den Nahmen haben, wegen seiner Ähnlichkeit mit ihrer milchweißen halb durchsichtigen Masse.

    (E?)(L?) http://www.out-of-air.ch/Porzellanschnecken
    (E2)(L1) http://www.kruenitz1.uni-trier.de/cgi-bin/callKruenitz.tcl


    Erstellt: 2010-07

  • Porzellanspinner
  • Porzellanspinner (W3)



    (E?)(L?) http://www.bloobook.net/browse/lepidoptera.php?lg=


    Erstellt: 2010-07

  • lädiert
  • lädiert (W3)

    Dt. "lädiert" = dt. "beschädigt" geht zurück auf lat. "laeder" = dt. "verletzen".

    Erstellt: 2010-07

  • use
  • use (W3)

    Engl. "use" = dt. "benutzen", "verwenden" geht zurück auf lat. "uti" ? = dt. "gebrauchen", "anwenden".

    Erstellt: 2010-07

  • Offensive
  • Offensive (W3)

    Die "Offensive" geht zurück auf lat. "offendere" = dt. "angreifen", "stören".

    Erstellt: 2010-07

  • mixen
  • mixen (W3)

    Dt. "mixen" geht auf lat. "miscere" = dt. "mischen" zurück.

    Erstellt: 2010-07

  • sub rosa
  • sub rosa (W3)

    Mit dem Ausdruck lat. "sub rosa" = dt. "unter der Rose", bezeichnet man etwas, das "unter dem Siegel der Verschwiegenheit" weitergegeben wird. Eine Erklärungsvariante besagt, dass bei den römischen Gastmählern Rosen zum Standard repertoire zählten. Und alles was während den Gastmahlen - also in rosengeschmücktem Umfeld - gesagt wurde, ob Klatsch und Tratsch oder intime Offenbarungen, unterlagen der Schweigepflicht.

    Erstellt: 2010-07

  • Microwave Oven
  • Mikrowellengerät
  • Microwave Oven
    Mikrowellengerät (W3)

    Das "Mikrowellengerät" wurde ursprünglich im zweiten Weltkrieg ein britischen Radaranlagen verwendet, um feindliche Flugzeuge zu erkennen. Der Wissenschaftler Percy Spencer mußte seine Tasche reinigen nachdem beim Experimentieren mit einer Magnetfeldröhre ein Schokoladenriegel darin geschmolzen war. Dies brachte ihn jedoch auf die Idee, mit Mikrowellen Nahrungsmittel zu erwärmen. Aber erst im Jahr 1967 kam dann der engl. "Microwave Oven", dt. "Mikrowellengerät", in den Handel. Und erst in den 1970er Jahren war er zu einem Preis zu haben, so dass er sich als Haushaltsgerät durchsetzen konnte.

    Erstellt: 2010-07

  • Krematorium
  • Krematorium (W3)

    Dt. "Krematorium" = dt. "Anlage für Feuerbestattungen" geht zurück auf lat. "cremare" = "verbrennen".

    Erstellt: 2010-07

  • Konstruktion
  • Konstruktion (W3)

    Dt. "Konstruktion" geht zurück auf lat. "constructio" = dt. "Verbindung". Das lat. "constructio" setzt sich seinerseits zusammen aus lat. "con-" = dt. "mit" und lat. "structura" = dt. "Bau", lat. "struere" = dt. "aufbauen", "(aneinander) fügen".

    Erstellt: 2010-07

  • trist
  • trist (W3)

    Dt. "trist" = dt. "trostlos", "freudlos" geht zurück auf lat. "tristis" = dt. "traurig".

    Erstellt: 2010-07

  • integer
  • integer (W3)

    Dt. "integer" = dt. "unbescholten" geht zurück auf lat. "integer" = dt. "unberührt", "unversehrt". Deshalb nennt man auch die "ganzen Zahlen" engl./math. "Integer".

    Das lat. "integer" setzt sich seinerseits zusammen aus lat. "in-" = dt. "un-", "nicht" und lat. "tangere" = dt. "tangieren", "berühren".

    Erstellt: 2010-07

  • delete
  • delete (W3)

    Engl. "delete" = dt. "löschen" geht zurück auf lat. "deletus" = dt. "zerstört".

    Erstellt: 2010-07

  • Crown Colonies
  • Dependent Territories
  • Overseas Territories
  • Crown Colonies
    Dependent Territories
    Overseas Territories (W3)

    Im Jahr 1981 wurden durch den "British Nationality Act" die bisherigen "Crown Colonies" (dt. "Kronkolonien") in "Dependent Territories" (dt. "abhängige Gebiete") umbenannt.

    Im Jahr 2002 wurden dann durch den "British Overseas Territories Act" eine weitere Umbenennung in "Overseas Territories" (dt. "Überseegebiete") durchgeführt.

    Erstellt: 2010-07

  • Hong Kong
  • Hong Kong (W3)

    Der Name der Stadt "Hong Kong" bedeutet "duftender Hafen". Dies bezieht sich darauf, dass hier ein großer Handel mit Gewürzen stattfand.

    Erstellt: 2010-07

  • quiet
  • quiet (W3)

    Engl. "quiet" = dt. "ruhig", "still" geht zurück auf lat. "quietus" = dt. "ruhig".

    Erstellt: 2010-07

  • Lude
  • Lude (W3)

    Für den im Rotlicht-Milieu anzutreffende "Lude" = dt. "Zuhälter" gibt es unterschiedliche Erklärungsansätze.
    Einmal ist "Lude" eine Kurzform für "Ludewig", "Ludwig", frz. "Louis". Und da die französischen Könige (im 17./18. Jh.) auf "Louis" abonniert waren und für ihre Mätressenwirtschaft bekannt waren, wurden sie als Bürger zum "Lude", zum "Zuhälter".
    Eine andere Herkunft könnte sich auf lat. "ludere" = dt. "spielen" beziehen. Vielleicht versetzten einige Spieler zunächst ihre Frauen beim Spiel und bauten darauf eine Geschäftsidee auf.

    Das weibliche Pendant, das "Luder", mhd. "luoder" = "durchtriebene Frau", könnte sich aus "Lude" entwickelt habe, könnte sich aber auch aus der Bedeutung "Leidende", "jemand, der einem Leid tut" entwickelt haben.

    In beiden Fällen fehlt mir noch ein "offizieller" Hinweis.

    Erstellt: 2010-07

  • tranquility
  • tranquillity
  • tranquility
    tranquillity (W3)

    Engl. "tranquility", "tranquillity" geht über französische Vermittlung zurück auf lat. "tranquillitas" = dt. "Ruhe". s. 1. Ruhe f, Friede(n) m, Stille

    Erstellt: 2010-07

  • merde
  • merde (W3)

    Wahrscheinlich der häufigste französische Fluchausdruck frz. "merde" geht zurück auf lat. "merda" = dt. "Kot".

    Erstellt: 2010-07

  • Spieletipps (spieletipps)
  • spieletipps
    Spieletipps

    (E?)(L?) http://www.spieletipps.de/
    Tausende Spiele - beschrieben, bewertet, getestet

    Erstellt: 2010-07

  • Models (showcast)
  • showcast
    Models

    (E?)(L?) http://www.showcast.de/


    Erstellt: 2010-07

  • Arbeits-abc (arbeits-abc)
  • arbeits-abc
    Arbeits-abc

    (E?)(L?) http://arbeits-abc.de/
    Tipps zu Arbeit und Karriere

    Erstellt: 2010-07

  • Malverina
  • Malverina (W3)

    Die weiße Rebsorte ist eine komplexe tschechische Neuzüchtung zwischen (Villard Blanc x Frühroter Veltliner) x (Merlot x Seibel 13666). Die Kreuzung erfolgte durch den Züchter Ing. L. Michlovský. Der Sortenschutz wurde im Jahre 2001 erteilt. Die spät reifende Rebe besitzt eine hohe Resistenz gegen Pilzkrankheiten. Sie erbringt vollmundige Weine mit einem aromatischen Zimtton. Bisher gibt es nur einen geringen Testanbau.

    (E3)(L1) http://www.wein-plus.de/glossar/M.htm


  • List of Indian states by the etymology of their name (wikipedia)
  • wikipedia
    List of Indian states by the etymology of their name

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_Indian_states_by_the_etymology_of_their_name
    The Republic of India was constituted in 1947 as a Union of states. The States Reorganization Act of 1956 rearranged state boundaries on linguistic lines and hence many states have names in their languages, and usually trace their origins to Sanskrit except Tamil Nadu (Tamil) and Karnataka (Kannada). Other states are however named due to their geographical characteristics, peculiar history or populations and colonial influences.

    State name (on map) In State Language Meaning Notes


  • Etymological list of counties of Romania (wikipedia)
  • wikipedia
    Etymological list of counties of Romania

    (E?)(L?) http://en.wikipedia.org/wiki/Etymological_list_of_counties_of_Romania
    This is a list of the origins of the names of counties of Romania. Many of the etymologies are Romanian interpretations of Slavonic names (e.g.: Gorj and Dolj), as the administration documents in the Middle Ages Romanian Principalities (Wallachia and Moldavia) were written in this language.

    County name Language of origin Meaning

    Sources
    This article is based on a translation of the December 10, 2004 version of the equivalent article on the Romanian Wikipedia.

    See also


  • List of U.S. counties named after women (wikipedia)
  • wikipedia
    List of U.S. counties named after women

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_U.S._counties_named_after_women
    List of U.S. counties named after women From Wikipedia, the free encyclopedia Jump to: navigation, search This is a list of U.S. counties which are named for women. Items may be listed in more than one category. This list is incomplete; you can help by expanding it. Contents [hide] 1 Ordinary people 2 Fictional 3 Titled noblewomen and queens 4 Native Americans 5 Saints 6 Aspects of the Virgin Mary 7 Counties indirectly named for women 8 Counties possibly named for women 9 See also Ordinary people Ada County, Idaho: Ada is named for Ada Riggs, the first pioneer child born in the area and the daughter of Boise, Idaho cofounder H.C. Riggs. Barton County, Kansas: Barton is named for Clara Barton, the famous American nurse. Bremer County, Iowa: Bremer is named for Fredrika Bremer, a Swedish novelist. Dare County, North Carolina: Dare is named for Virginia Dare, the first English child born in the New World who disappeared with the Lost Colony. East Feliciana Parish, Louisiana: East Feliciana is allegedly named for Felicite de Gálvez, the wife of Bernardo de Gálvez, a Spanish governor of the Louisiana Territory. Florence County, South Carolina: Florence is named for Florence Harllee, a daughter of W. W. Harllee, a president of the Wilmington and Manchester Railroad. Florence County, Wisconsin: Florence is named for Florence Julst, the first woman pioneer in the region. Grainger County, Tennessee: Grainger is named for Mary Grainger Blount, the wife of William Blount, the only governor of the Southwest Territory (modern Tennessee). Hart County, Georgia: Hart is named for Nancy Hart, a woman sharpshooter and patriot in the American Revolutionary War. Josephine County, Oregon: Josephine is named for Virginia "Josephine" Rollins, the first European-American woman to settle in southern Oregon. Marshall County, Oklahoma: Marshall is named for the mother of George A. Henshaw, a delegate to the state constitutional convention, Marshall having been her maiden name. Merrick County, Nebraska: Merrick is named after Elvira Merrick, wife of Henry W. DePuy, a territorial legislator. Montour County, Pennsylvania: Montour is named for Madame Montour, a French-Indian woman who was involved in Native American affairs. Wake County, North Carolina: Wake is named for Margaret Wake, a London heiress and the wife of William Tryon, a colonial governor of North Carolina. West Feliciana Parish, Louisiana: West Feliciana is allegedly named for Felicite de Gálvez, the wife of Bernardo de Gálvez, a Spanish governor of the Louisiana Territory. Fictional Attala County, Mississippi: Attala is named for Attala or Atala, a fictional Native American heroine from a story by François-René de Chateaubriand. Evangeline Parish, Louisiana: Evangeline is named after the heroine of the poem "Evangeline" by Henry Wadsworth Longfellow. Titled noblewomen and queens Amelia County, Virginia: Amelia is named for Princess Amelia of Great Britain, daughter of George II. Anne Arundel County, Maryland: Anne Arundel is named for Anne Arundell, the wife of Cæcilius Calvert, 2nd Baron Baltimore and daughter of Thomas Arundell, 1st Baron Arundell of Wardour. Augusta County, Virginia: Augusta is named for Augusta of Saxe-Gotha, wife of Frederick, Prince of Wales and mother of George III of Great Britain. Caroline County, Maryland: Caroline is named for Lady Caroline Eden, the daughter of Charles Calvert, 5th Baron Baltimore, sister of Frederick Calvert, 6th Baron Baltimore, and wife of Robert Eden, the last colonial governor of Maryland. Caroline County, Virginia: Caroline is named for Caroline of Ansbach, wife of George II of Great Britain. Charlotte County, Virginia: Charlotte is named for Charlotte of Mecklenburg-Strelitz, wife of George III of Great Britain. Dutchess County, New York: Dutchess is named for Lady Anne Hyde, the Duchess of York and wife of the future King James II of England. Isabella County, Michigan: Isabella is named for Queen Isabella of Castile, who patronized Christopher Columbus. King and Queen County, Virginia: King and Queen is named for King William III of England and Queen Mary II of England. Louisa County, Virginia: Louisa is named for Princess Louise, daughter of George II of Great Britain. Mecklenburg County, North Carolina: Mecklenburg is named for Charlotte of Mecklenburg-Strelitz, wife of George III of Great Britain. Mecklenburg County, Virginia: Mecklenburg is named for Charlotte of Mecklenburg-Strelitz, wife of George III of Great Britain. Queen Anne's County, Maryland: Queen Anne's is named for Queen Anne of Great Britain. Queens County, New York: Queens is named for Catherine of Braganza, Queen of England and the wife of Charles II of England. Native Americans Angelina County, Texas: Angelina is named for Angelina, a Hainai Native American woman who assisted early Spanish missionaries and was named Angelina by them. Marinette County, Wisconsin: Marinette is named for Marinette, a 19th century trader who was the daughter of a French-Canadian trapper and a Menominee woman. Montour County, Pennsylvania: Montour is named for Madame Montour, a French-Indian woman who was involved in Native American affairs. Pocahontas County, West Virginia: Pocahontas is named for Pocahontas, the famous Native American who played a leading role in the history of the first permanent English settlements in North America. Pocahontas County, Iowa: Pocahontas is named for Pocahontas, the famous Native American who played a leading role in the history of the first permanent English settlements in North America. Tama County, Iowa: Tama is named for any of several Native American chiefs or chief's wives, over which there is dispute. Tippah County, Mississippi: Tippah is named for Tippah, wife of Pontotoc, an important Chickasaw leader. Winona County, Minnesota: Winona is named after Winona, a Dakota woman of distinction who was a cousin of the last of three chiefs named Wabasha. Saints St. Helena Parish, Louisiana: St. Helena is named for Saint Helena of Constantinople, the mother of Constantine the Great. St. Lucie County, Florida: St. Lucie was named for the Spanish-era Ais town of Santa Lucea, presumed to have been named by the Spanish for Saint Lucie of Syracuse. Ste. Genevieve County, Missouri: Ste. Genevieve is named after Sainte Genevieve, the patron saint of Paris. Santa Barbara County, California: Santa Barbara is named for Saint Barbara, patroness of fire. Santa Clara County, California: Santa Clara is named for Mission Santa Clara, which was in turn named for Saint Clara de Asís. Aspects of the Virgin Mary Assumption Parish, Louisiana: Assumption is named for the Assumption of Mary into heaven. Dolores County, Colorado: Dolores is named for the Dolores River, originally Rio de Nuestra Senora de los Dolores, or, in English, River of our Lady of Sorrows. Guadalupe County, New Mexico: Guadalupe is named for Our Lady of Guadalupe, the patron saint of the Americas. Los Angeles County, California: Los Angeles is named for the fact that Gaspar de Portolà's explorers reached what was then the Native American village of Yangna on August 2, 1769, the feast day of Nuestra Señora la Reina de Los Angeles de Porciúncula (English: Our Lady, Queen of the Angels of Porciúncula). St. Mary Parish, Louisiana: St. Mary is named for the Blessed Virgin Mary, the mother of Jesus. St. Mary's County, Maryland: St. Mary's is named for the Blessed Virgin Mary, the mother of Jesus. Counties indirectly named for women Doña Ana County, New Mexico: Doña Ana is named for its first county seat of Doña Ana, New Mexico, which in turn was named for Doña Ana Robledo, a 17th-century woman known for her charitable giving. Fluvanna County, Virginia: Fluvanna is named for an archaic term for the James River, fluv anna or River of Anne. Haines Borough, Alaska: Haines Borough is named after Haines, Alaska, which is named in turn for Mrs. F. E. Haines, the community leader who raised funds for a religious mission to the local Chilkat Native American tribe. Judith Basin County, Montana: Judith Basin is named for the Judith River, which in turn is named for Julia Hancock, the sweetheart and future wife of William Clark of the Lewis and Clark Expedition, who discovered the river; the misspelling is because Clark mistook her name to be Judith. Counties possibly named for women Culpeper County, Virginia: Culpeper is named for one of three members of the Colepeper family, of which two were women: Thomas Colepeper, 2nd Baron Colepeper of Thoresway, a colonial governor of Virginia; his first wife Margaretta van Hesse, called Margaret, Lady Colepeper; or their daughter, Thomas's heir and only surviving issue, Catherine Colepeper. Elmore County, Idaho: Elmore is named for the Ida Elmore mines, which may have been named for a woman named Ida Elmore. Ida County, Iowa: Ida is named for possibly Ida Smith, the first European-American child born in the county. Louisa County, Iowa: Louisa is named for either Louisa Massey of Dubuque, Iowa, who, according to legend, killed the murderer of her brother; or Louisa County, Virginia. Maries County, Missouri: Maries is named for the Maries River, which may be named after one or more Maries. St. Clair County, Michigan: St. Clair is named for either Arthur St. Clair, the first governor of the Northwest Territory; or Saint Clare of Assisi, on whose feast day Lake St. Clair was discovered. Tama County, Iowa: Tama is named for any of several Native American chiefs or chief's wives, over which there is dispute. See also County (United States)

  • Lists of U.S. county name etymologies (wikipedia)
  • wikipedia
    Lists of U.S. county name etymologies

    (E?)(L?) http://en.wikipedia.org/wiki/Lists_of_U.S._county_name_etymologies
    Lists of U.S. county name etymologies From Wikipedia, the free encyclopedia Jump to: navigation, search These are lists of U.S. county name etymologies. Many U.S. states have counties named after U.S. presidents such as Washington, Madison, Polk, Jefferson, etc. Counties are also commonly named after famous individuals, local Native American tribes once in the area, cities located within the county, and land or water features (Cerro Gordo County, Iowa, meaning "Fat Hill" in Spanish, and Lake County, Illinois, on Lake Michigan). Contents [hide] 1 Alphabetically 2 By state 3 Miscellaneous 4 See also 5 External links Alphabetically List of U.S. county name etymologies, A-D List of U.S. county name etymologies, E-I List of U.S. county name etymologies, J-M List of U.S. county name etymologies, N-R List of U.S. county name etymologies, S-Z By state [hide]v • d • eLists of etymologies of United States county, parish, borough and census area names Alabama · Alaska · Arizona · Arkansas · California · Colorado · Connecticut · Delaware · Florida · Georgia · Hawaii · Idaho · Illinois · Indiana · Iowa · Kansas · Kentucky · Louisiana · Maine · Maryland · Massachusetts · Michigan · Minnesota · Mississippi · Missouri · Montana · Nebraska · Nevada · New Hampshire · New Jersey · New Mexico · New York · North Carolina · North Dakota · Ohio · Oklahoma · Oregon · Pennsylvania · Rhode Island · South Carolina · South Dakota · Tennessee · Texas · Utah · Vermont · Virginia · Washington · West Virginia · Wisconsin · Wyoming Miscellaneous List of U.S. counties named after prominent Confederate historical figures List of the most common U.S. county name etymologies List of U.S. counties named after animals List of U.S. counties named after other U.S. counties List of U.S. counties named after personal first names List of U.S. counties named after plants List of U.S. counties named after rivers List of U.S. counties named after women List of U.S. counties that share names with U.S. states List of U.S. counties named after U.S. Presidents See also U.S. state County (United States) List of U.S. place names of Spanish origin External links GEOBOPological Survey: The most popular county names, from Washington to Buffalo

  • List of places in United States named after people (wikipedia)
  • wikipedia
    List of places in United States named after people

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_places_in_United_States_named_after_people
    This is a list of places in the United States of America which are named after people. Adamstown, California – George Adams (founder) Albuquerque, New Mexico – Francisco Fernández de la Cueva, 8th Duke of Alburquerque Alexandria, Virginia – John Alexander (settler) Allentown, Pennsylvania – William Allen Anderson, Indiana – Chief William Anderson Anderson, South Carolina – Gen. Robert Anderson Angels Camp, California – Henry P. Angel (early settler and merchant) Ankeny, Iowa – John Fletcher Ankeny Annapolis, Maryland – Anne of Great Britain Ansonia, Connecticut – Anson Greene Phelps Arbuckle, California – Tacitus R. Arbuckle (early landowner and settler) Arnold, California – Bob and Bernice Arnold (early local merchants) Astoria, Oregon – John Jacob Astor Atlanta, Georgia – Atlas (indirectly via the Western and Atlantic Railroad and the Atlantic Ocean) Austin, Texas – Stephen F. Austin Avery, California – George J. Avery (first postmaster) Baird, Texas – Matthew Baird (president of Baldwin Locomotive Works) Bakersfield, California – Col. Thomas Baker Baltimore, Maryland – Lord Baltimore Barber, California – O. C. Barber, president of the Diamond Match Company Barrow, Alaska – Sir John Barrow Bartlett, Illinois – Luther Bartlett Barstow, California – William Barstow Strong (ATSF president) Beltrami County, Minnesota – Giacomo Beltrami Belzoni, Mississippi – Giovanni Battista Belzoni Benicia, California – Francisca Benicia Carillo de Vallejo Billings, Montana – Frederick H. Billings Binghamton, New York – William Bingham Bismarck, North Dakota – Otto von Bismarck Bowie, Maryland – William D. Bowie (colonel) Broderick, California – David C. Broderick (U.S. senator) Brownsville, Calaveras County, California – Alfred Brown Bryan, Texas – William Joel Bryan Bryte, California – Mike Bryte, local farmer and landowner Burbank, California – David Burbank (dentist) Burson, California – David S. Burson (railroad man) Cadenasso, California – Nicolo Cadenasso (early settler) Camp Connell, California – John F. Connell (landowner and first postmaster) Camp Pardee, California – George Pardee (governor of California) Campbell, California – Benjamin Campbell (founder) Carson City, Nevada – Kit Carson Carson Hill, California – Sgt. James H. Carson Chardon, California – Charles Langdon (early settler) Charles Town, West Virginia – Charles Washington (founder; younger brother of George Washington) Charlotte, North Carolina – Charlotte of Mecklenburg-Strelitz Cicero, New York – Cicero Cincinnati, Ohio – Lucius Quinctius Cincinnatus (indirectly, via the Society of the Cincinnati) Christiana, Delaware – Queen Christina of Sweden Clarksburg, California – Robert C. Clark (early settler) Clayton, California – Joel Henry Clayton (founder) Cleveland, Ohio – Moses Cleaveland (note spelling) Columbus, Ohio - Named after Christoper Columbus Compton, California – Griffith D. Compton (settler) Cooperstown, New York – William Cooper Cudahy, California – Michael Cudahy Cudahy, Wisconsin – Patrick Cudahy Dallas, Texas – George M. Dallas Danville, California – Daniel Inman (local landowner) Davenport, Iowa – Col. George Davenport Davie, Florida – Randolph P. Davie (developer) Davis, California – Jerome C. Davis (local farmer) Dayton, Ohio – Jonathan Dayton Daytona Beach, Florida – Matthias Day Denver, Colorado – James W. Denver DeSabla, California – Eugene De Sabla (engineer) Diamondville, California – James Diamond Dobbins, California – William M. and Mark D. Dobbins (early settlers) Douglas Flat, California – Tom Douglas (early merchant) Downers Grove, Illinois – Pierce Downer (settler) Downey, California – John G. Downey Dubuque, Iowa – Julien Dubuque Duluth, Minnesota – Daniel Greysolon, Sieur du Lhut Dunnigan, California – A. W. Dunnigan (early settler) Durham, California – W.W. Durham (member of the California State Assembly) Edison, Georgia, Edison, New Jersey – Thomas Edison Edwardsville, Illinois – Ninian Edwards El Macero, California – Bruce Mace, local landowner Emeryville, California – Joseph Stickney Emery, local landowner Epperson, California – Brutus E Eperson, first postmaster Eugene, Oregon – Eugene Franklin Skinner Evanston, Illinois – John Evans Evansville, Indiana – Robert Morgan Evans Fagan, California – Edward Fagan (local landowner) Fairbanks, Alaska – Charles W. Fairbanks Fargo, North Dakota – William Fargo Farragut, Tennessee, and other Farraguts – David Farragut Fayetteville, North Carolina and other Fayettevilles – Gilbert du Motier, marquis de La Fayette Fitchburg, Massachusetts – John Fitch (settler) Florence, Kentucky – Florence Conner (wife of early settler) Florence, South Carolina – Florence Hartlee (daughter of a railroad president who lived in the area) Forbestown, California – B.F. Forbes (local store owner) Fort Collins, Colorado – Col. William O. Collins Fort Lauderdale, Florida – William Lauderdale (major) Fort Lee, New Jersey – Charles Lee Fort Wayne, Indiana – Anthony Wayne Fort Worth, Texas – William Jenkins Worth Fouts Springs, California – John F. Fouts, who discovered the springs Fredericksburg, Virginia – Frederick, Prince of Wales Fremont, California, and numerous other Fremonts – John C. Frémont Fullerton, California – George H. Fullerton, president of the Pacific Land and Improvement Company Galesburg, Illinois – George Washington Gale Gallatin, Tennessee and other Gallatins – Albert Gallatin Gary, Indiana – Elbert Henry Gary Georgetown, Washington, D.C. – George II of Great Britain Gettysburg, Pennsylvania – Samuel Gettys (settler) Greensboro, North Carolina – Nathanael Greene Gridley, California – George W. Gridley (founder) Gurnee, Illinois – Walter S. Gurnee Hagerstown, Maryland – Jonathan Hager Harrisburg, Pennsylvania – John Harris, Sr. Hathaway Pines, California – Robert B. Hathaway (first postmaster) Hayward, California – Alvinza Hayward Hershey, California – David N. Hershey (California assembly member) Hodson, California – J.J. Hodson (copper mining financier) Hoffman Estates, Illinois – Sam and Jack Hoffman (builders) Hopkinsville, Kentucky – Samuel Hopkins (general) Houston, Texas - Sam Houston Huntington, West Virginia – Collis P. Huntington Huntington Beach, California – Henry E. Huntington Huntsville, Alabama – John Hunt (settler) Hylandville, California – L.C. Hyland (founder) Jackson, California – Col. Alden Jackson Jackson, Michigan – Andrew Jackson Jackson, Mississippi – Andrew Jackson Jacksonville, Florida – Andrew Jackson Jacobs Corner, California – Mattie Jacobs (first postmaster) Jefferson City, Missouri – Thomas Jefferson Jenny Lind, California – Jenny Lind Jesus Maria, California – Jesus Maria (local farmer) Jim Thorpe, Pennsylvania – Jim Thorpe Joe, Montana – Joe Montana Joplin, Missouri – a Methodist minister in the new city Juneau, Alaska – Joe Juneau Keizer, Oregon – Thomas Dove Keizur Kirkwood, California – Zack Kirkwood (rancher and early settler) Kiryas Joel, New York – Joel Teitelbaum, rabbi of Satmar Kit Carson, California – Kit Carson Kit Carson, Colorado – Kit Carson Knights Landing, California – Dr. William Knight (early settler) Knightsen, California – George W. Knight (town founder) and his wife Christina Christensen Knoxville, Tennessee – Henry Knox Kosciusko, Mississippi – Tadeusz Kosciuszko Kotzebue, Alaska – Otto von Kotzebue Lafayette, Louisiana and other Lafayettes – Gilbert du Motier, marquis de La Fayette Lake Charles, Louisiana – Charles Sallier Latrobe, Pennsylvania – Benjamin Henry Latrobe, II Leesville, California – Lee Harl (local landowner) Levittown, New York and other Levittowns – William Levitt Lincoln, Nebraska – Abraham Lincoln Livermore, California – Robert Livermore Livingston, New Jersey – William Livingston Los Angeles – Our Lady the Queen of the Angels Louisville, Kentucky – Louis XVI Lubbock, Texas – Thomas Saltus Lubbock Madison, Wisconsin – James Madison Marsh Creek Springs, California – John Marsh (early settler) Marshall, Texas – John Marshall Marklee Village, California – Jacob Marklee (early settler) Markleeville, California – Jacob Marklee (early settler) Martinez, California – Don Ygnacio Martínez (landowner) McAllen, Texas – John McAllen (settler) McHenry, Illinois – William McHenry McMinnville, Tennessee – Joseph McMinn Merritt, California – Hiram P. Merritt (early settler) Milton, California – Milton Latham (railroad engineer) Modesto, California – William Chapman Ralston, reputed for being a modest man Monroe, New York – James Monroe, American President Montgomery, Alabama and Montgomery, Minnesota – Richard Montgomery Moraga, California – Joaquin Moraga (explorer and landowner) Morgantown, West Virginia – Zackquill Morgan Morton Grove, Illinois – Levi P. Morton Murphys, California – Daniel & John Murphy (early miners and settlers) Naperville, Illinois – Joseph Naper Nashville, Tennessee – Francis Nash Neals Diggins, California – Sam Neal (founder) Nickerson, Kansas – Thomas Nickerson (ATSF president) Niles, Fremont, California – Addison Niles Norman, Oklahoma – Abner E. Norman (surveyor) Nortonville, California ‐ Noah Norton (founder) O'Fallon, Missouri – John O. Fallon Orinda, California – Katherine Philips (a poet whose nickname was "Matchless Orinda") Orlando, Florida – Orlando Reeves Orloff, California – Orloff Miller (early settler) Owensboro, Kentucky – Abraham Owen Oxnard, California – Henry, Ben,James and Robert Oxnard Paterson, New Jersey – William Paterson Pennsylvania – William Penn (Penn's Woods) Perris, California – Fred T. Perris Pierre, South Dakota – Pierre Chouteau, Jr. Pittsburgh, Pennsylvania – William Pitt the Elder Pittsfield, Massachusetts – William Pitt Pleasanton, California – Alfred Pleasonton (Union Army general) Provo, Utah – Étienne Provost Pulaski, Tennessee and other Pulaskis – Kazimierz Pulaski Pullman, 3 places in Michigan/Washington/West Virginia, named after George Pullman Pullman, Chicago – George Pullman and Solon S. Beman Putnam, Connecticut – Israel Putnam Quincy, Massachusetts – Colonel John Quincy Raleigh, North Carolina – Sir Walter Raleigh Roswell, Georgia – Roswell King, founder Rumsey, California – Captain D.C. Rumsey, early settler St. Louis, Missouri – Saint Louis St. Paul, Minnesota – Saint Paul San Andreas, California – Saint Andrew San Antonio, Texas – Saint Anthony of Padua San Diego, California – Saint James San Francisco, California – Saint Francis San Jose, California – Saint Joseph San Leandro, California – Saint Leander of Seville San Lorenzo, California – Saint Lawrence San Luis Obispo, California – Saint Louis of Toulouse San Mateo, California – Saint Matthew San Pablo, California – Saint Paul Saranap, California – Sara Napthaly (mother of a railroad man) Schererville, Indiana – Nicholas Scherer (German settler) Seattle, Washington – Chief Seattle Seward, Alaska – William H. Seward Smartsville, California – Jim Smart (Gold Rush settler and merchant) Sparks, Nevada – John Sparks Stege, California – Richard Stege (founder and landowner) Stockton, California – Robert F. Stockton Strong City, Kansas – William Barstow Strong (ATSF president) Sutter, California – John A. Sutter (pioneer of the California Gold Rush) Sutter Creek, California – John A. Sutter Sutter Hill, California – John A. Sutter Temple, Texas – Bernard Moore Temple (civil engineer) Tinley Park, Illinois – Samuel Tinley, Sr. (railroad station agent) Tormey, California – Patrick Tormey (landowner) Torrance, California – Jared Sidney Torrance Tustin, California – Columbus Tustin Twain Harte, California – Mark Twain and Bret Harte Vacaville, California – Juan Manuel Vaca Vallejo, California – Mariano Guadalupe Vallejo Victorville, California – Jacob Nash Victor Wallace, California – John Wallace (surveyor) Warrenville, Illinois – Julius Warren (settler) Washington, D.C. – George Washington Webster, Massachusetts – Daniel Webster Wilkes-Barre, Pennsylvania – John Wilkes and Isaac Barre Williams, California – W.H. Williams (planner of the townsite) Williamstown, Massachusetts – Ephraim Williams Wilmette, Illinois – Antoine Ouilmette (French-Canadian fur trader) Wilseyville, California – Lawrence A. Wilsey (corporate executive) Woodfords, California – Daniel Woodford (early settler) Former names Black's was the name of Yolo, California – J.J. Black (early settler) Brannan Springs' was the name of Woodfords, California – Samuel Brannan (Gold Rush figure) Carson's Creek was the name of Angels Camp, California – Kit Carson Hupp and Hupps Mill were names of DeSabla, California – John Hupp (early sawmill owner) Foremans was the name of Fourth Crossing, California – David Foreman (town founder) Langville was the name of Capay, California – John Arnold Lang (early settler) Moores Station was the name of Honcut, California – John C. Moore (first postmaster) Smith's Landing was the of Antioch, California – William and Joseph Smith (early settlers) See also List of places named after people List of country subdivisions named after people Buildings and structures named after people List of eponyms of airports Lists of places by eponym List of eponyms Lists of etymologies

  • List of eponyms of stadiums (wikipedia)
  • wikipedia
    List of eponyms of stadiums

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_eponyms_of_stadiums
    List of eponyms of stadiums From Wikipedia, the free encyclopedia Jump to: navigation, search This is a list of eponyms of stadiums. Contents [hide] 1 Argentina 2 Austria 3 Chile 4 Côte d'Ivoire 5 Cuba 6 Dominican Republic 7 Finland 8 France 9 Germany 10 Greece 11 India 12 Iraq 13 Ireland 14 Italy 15 Netherlands 16 Nicaragua 17 Nigeria 18 Paraguay 19 Peru 20 Puerto Rico 21 Russia 22 Spain 23 Trinidad and Tobago 24 Turkey 25 United Kingdom 26 United States 27 Uruguay 28 Zambia Argentina Estadio Brigadier Estanislao López, Santa Fe, named for Estanislao López Austria Arnold Schwarzenegger-Stadium (now UPC-Arena) in Graz, named for Arnold Schwarzenegger Ernst Happel Stadion, Vienna, named for Ernst Happel Gerhard Hanappi Stadium, Hütteldorf, named for Gerhard Hanappi Chile Estadio Carlos Dittborn, Arica, named for Carlos Dittborn Côte d'Ivoire Stade Félix Houphouët-Boigny, Abidjan, named for Félix Houphouët-Boigny Cuba Calixto García Íñiguez Stadium, Holguín, named for Calixto García Estadio Augusto César Sandino, Santa Clara, named for Augusto César Sandino Estadio Guillermón Moncada, Santiago de Cuba, named for Guillermón Moncada Nguyen Van Troi Stadium, Guantánamo, named for Nguyen Van Troi Dominican Republic Estadio Julian Javier, San Francisco de Macorís, named for Julián Javier Estadio Olímpico Juan Pablo Duarte, Santo Domingo, named for Juan Pablo Duarte Estadio Tetelo Vargas, San Pedro de Macorís, named for Tetelo Vargas Finland Paavo Nurmi Stadion, Turku, named for Paavo Nurmi France Court Philippe Chatrier, Paris, named for Philippe Chatrier (former head of French Tennis Federation) Stade Jean-Bouin, Paris, named for Jean Bouin Stade Jean-Bouin, Angers, also named for Jean Bouin Stade Jean-Pierre Papin, Lesquin, named for Jean-Pierre Papin Germany Dietmar-Hopp-Stadion, Sinsheim, named for Dietmar Hopp Gottlieb-Daimler-Stadion, Stuttgart, named for Gottlieb Daimler Karl Liebknecht Stadion, Potsdam-Babelsberg, named for Karl Liebknecht Rudolf-Harbig-Stadion, Dresden, named for Rudolf Harbig Greece Apostolos Nikolaidis Stadium, Athens, named for Apostolos Nikolaidis Karaiskakis Stadium, Piraeus named for Georgios Karaiskakis Kleanthis Vikelidis Stadium, Thessaloniki named for Kleanthis Vikelidis India Chennai Jawaharlal Nehru Stadium, Chennai, named for Jawaharlal Nehru Guru Gobind Singh Stadium, Ludhiana, named for Guru Gobind Singh Jawaharlal Nehru Stadium, New Delhi, named for Jawaharlal Nehru Iraq Franso Hariri Stadium, Arbil, named for Franso Hariri Ireland Croke Park, Dublin, named for Thomas Croke FitzGerald Stadium, Killarney, named for Dick FitzGerald (Gaelic games athlete) Páirc Uí Chaoimh, Cork, named for Padraig Ó Chaoimh (builder of the modern Gaelic Athletic Association) Italy Stadio Alberto Braglia, Modena, named for Alberto Braglia Stadio Alberto Picco, La Spezia, named for Alberto Picco Stadio Angelo Massimino, Catania, named for Angelo Massimino Stadio Armando Picchi, Livorno, named for Armando Picchi Stadio Artemio Franchi, Florence, named for Artemio Franchi Stadio Artemio Franchi, Siena, named for Artemio Franchi Stadio Carlo Speroni, Busto Arsizio, named for Carlo Speroni Stadio Danilo Martelli, Mantua, named for Danilo Martelli Stadio Ennio Tardini, Parma, named for Ennio Tardini Stadio Erasmo Iacovone, Taranto, named for Erasmo Iacovone Arena Garibaldi - Romeo Anconetani, Pisa, named for Giuseppe Garibaldi and Romeo Anconetani Stadio Gino Pistoni, Ivrea, named for Gino Pistoni Stadio Giorgio Ascarelli, Naples, named for Giorgio Ascarelli Stadio Giuseppe Meazza, Milan, named for Giuseppe Meazza Stadio Guido Biondi, Lanciano, named for Guido Biondi Stadio Luigi Ferraris, Genoa, named for Luigi Ferraris Stadio Marcantonio Bentegodi, Verona, named for Marcantonio Bentegodi Stadio Mario Rigamonti, Brescia, named for Mario Rigamonti Stadio Nereo Rocco, Trieste, named for Nereo Rocco Stadio Nicola Ceravolo, Catanzaro, named for Nicola Ceravolo Stadio Omobono Tenni, Treviso, named for Omobono Tenni Stadio Oreste Granillo, Reggio Calabria, named for Oreste Granillo Stadio Pino Zaccheria, Foggia, named for Pino Zaccheria Stadio Pio XII, Albano Laziale, named for Pope Pius XII Netherlands Abe Lenstra Stadion, Heerenveen, named for Abe Lenstra Nicaragua Estadio Dennis Martinez, Managua, named for Dennis Martínez Nigeria Sani Abacha Stadium, Kano, named for Sani Abacha Paraguay Estadio Roberto Bettega, Asunción, named for Roberto Bettega Peru Estadio Teodoro Lolo Fernandez, Lima, named for Teodoro "Lolo" Fernandez Puerto Rico Estadio Hiram Bithorn, San Juan, named for Hiram Bithorn Juan Pachín Vicéns Auditorium, Ponce, named for Juan "Pachín" Vicéns Estadio Roberto Clemente, Carolina, named for Roberto Clemente Russia Eduard Streltsov Stadium, Moscow, named for Eduard Streltsov Spain Estadio Santiago Bernabéu, Madrid, named for Santiago Bernabéu Estadio Vicente Calderón, Madrid, named for Vicente Calderón Trinidad and Tobago Hasely Crawford Stadium, Port of Spain, named for Hasely Crawford Turkey Ali Sami Yen Stadium, Istanbul, named for Ali Sami Yen Antalya Atatürk Stadium, Antalya, named for Mustafa Kemal Atatürk Atatürk Olympic Stadium, Istanbul, named for Mustafa Kemal Atatürk Atatürk Stadyumu, Denizli, named for Mustafa Kemal Atatürk Atatürk Stadyumu, Eskisehir, named for Mustafa Kemal Atatürk BJK Inönü Stadium, Istanbul, named for Ismet Inönü Bursa Atatürk Stadyumu, Bursa, named for Mustafa Kemal Atatürk Cemal Gürsel Stadyumu, Erzurum, named for Cemal Gürsel Diyarbakir Atatürk Stadium, Diyarbakir, named for Mustafa Kemal Atatürk Izmir Atatürk Stadyumu, Izmir, named for Mustafa Kemal Atatürk Kayseri Atatürk Stadyumu, Kayseri, named for Mustafa Kemal Atatürk Konya Atatürk Stadium, Konya, named for Mustafa Kemal Atatürk Rize Atatürk Stadium, Rize, named for Mustafa Kemal Atatürk Sakarya Atatürk Stadyumu, Sakarya, named for Mustafa Kemal Atatürk Sükrü Saracoglu Stadium, Istanbul, named for Sükrü Saracoglu United Kingdom Boleyn Ground (more commonly known as Upton Park), London, England, named for Anne Boleyn Kassam Stadium, Oxford, England, named for Firoz Kassam Madejski Stadium, Reading, England, named for John Madejski United States Main article: List of eponyms of stadiums in the United States Uruguay Estadio José Nasazzi, Montevideo, named for José Nasazzi Estadio Luis Franzini, Montevideo, named for Luis Franzini Zambia Dag Hammerskjold Stadium, Ndola, named for Dag Hammarskjöld

  • Horus
  • Horus (W3)

    "Horus" ist der Sohn der ägyptischen Göttin Isis und dem Gott Osiris.

    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/goetteranf3.htm


  • Horusauge
  • Horusauge (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://de.wikipedia.org/wiki/Horusauge
    ...
    Das Horusauge oder Udjat-Auge ist eine ägyptische Hieroglyphe, die neben ihrer magischen Bedeutung auch für die Mathematik gebraucht wurde. Es hat in der Gardiner-Liste die Nummer D10.
    ...


  • Seth
  • Seth (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/goetteranf5.htm


  • Sinuhe
  • Sinuhe (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/sinuhe1.htm
    Die Geschichte des Sinuhe

  • Hatschepsut
  • Hatschepsut (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/hatschepsut1.htm
    Die Geburtslegende von Hatschepsut

  • Harem
  • Harem (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/haremsver.htm
    Die Haremsverschwörung

  • Thutmosis
  • Thutmosis (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/thutspo.htm
    Thutmosis III. der Sportler

  • Amun
  • Amun (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/amunsegen.htm
    Amuns Segen

    (E?)(L?) http://www.selket.de/danklied.htm
    Danklied an Amun

    (E?)(L?) http://www.selket.de/loblied.htm
    Loblied auf Amun

  • Nubier
  • Nubier (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/nubier.htm
    Die elenden Nubier

  • Ramses
  • Ramses (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/kadesch.htm
    Ramses und die Schlacht von Kadesch

    (E?)(L?) http://www.selket.de/frvertag.htm
    Der Friedensvertrag zwischen Ramses und Hattusili

    (E?)(L?) http://www.selket.de/liedthron.htm
    Lied auf die Thronbesteigung Ramses IV.

  • Echnaton
  • Echnaton (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/atonhymnus.htm
    Der Sonnengesang Echnatons

  • Hapi
  • Hapi (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/hymnushapi.htm
    Hymnus an Hapi

  • Ipuwer
  • Ipuwer (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/ipuwer.htm
    Das Klagelied des Ipuwer

  • Tutanchamun
  • Tutanchamun (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/tutfluch1.htm
    Der Fluch Tutanchamuns

  • Echnaton
  • Echnaton (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/echnatonfluch1.htm
    Der Fluch Echnatons

  • Ägyptomanie
  • Ägyptomanie (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http://www.selket.de/aegyptomanie.htm


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • (W3)



    (E?)(L1) http://www.selket.de/
    (E?)(L?) http:///


  • to work like a Trojan
  • to work like a Trojan (W3)

    Engl. "to work like a Trojan" = dt. "arbeiten wie ein Pferd", bezieht sich auf die "Trojaner", die Einwohner von "Troja". In den Epen "Aeneis" von Vergil und "Ilias" von Homer, werden die Trojaner als schwer arbeitend bezeichnet.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-22


    Erstellt: 2010-01

  • to feel one's heart leap into one's throat
  • to feel one's heart leap into one's throat (W3)

    Engl. "to feel one's heart leap into one's throat" = dt. "jemandem rutscht das Herz in die Hose", beschreibt die körperlich spürbaren Folgen einer starken Aufregung. Das im Hals spürbare Herz ist in England seit 1548 nachweisbar.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-21


    Erstellt: 2010-01

  • Doppler-Effekt
  • Doppler-Effekt (W3)

    Der "Doppler-Effekt" hat nichts mit dem "Doppel-Klick" zu tun. Der "Doppler-Effekt" ist benannt nach "??? Doppler", der diese Erscheinung im Jahr ??? beschrieb. Zunächst bezog er sich auf den Effekt bei optischen Erscheinungen (Farbverschiebung) und dann erst auf akkustische Erscheinungen (Tonverschiebung". Der Nachweis wurde zuerst im akkustischen Bereich mit Hilfe eines Zuges und einem Bläseraufgebot erbracht.

    (E?)(L?) http:///


    Erstellt: 2010-01

  • to be henpecked
  • to be henpecked (W3)

    Engl. "to be henpecked" = dt. "unter dem Pantoffel stehen", und bezieht sich auf den von der Henne gequälten Hahn und kommt seltsamerweise aus der Welt der Seefahrt. Im 17. Jh. wurde ein Schiff das die Frau des Kapitäns an Bord hatte als "hen frigate" bezeichnet. Da sich diese anscheinend öfters in die Vorgänge an Bord einmischte wurde der so gequälte Kapitän zum engl. "henpecked husband".

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-20


    Erstellt: 2010-01

  • a dish fit for the gods
  • a dish fit for the gods (W3)

    Engl. "a dish fit for the gods" = dt. "eine Speise für die Götter sein", geht auf William Shakespeare zurück. Dort findet man die Redewendung zum ersten Mal in "Julius Caesar" aus dem jahr 1601. Dort läßt er Brutus in Bezug auf die geplante Ermordung Cäsars sagen: "Let's carve him as a dish fit for the gods". Das sollte zum Ausdruck bringen, dass sein Körper zur Übergabe an die Götter vorbereitet werden sollte.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-19


    Erstellt: 2010-01

  • GPS - Global Positioning System
  • GPS (W3)

    "GPS" steht für "Global Positioning System".

    Erstellt: 2010-01

  • MIT - Massachusetts Institute of Technology
  • MIT (W3)

    "MIT" steht für "Massachusetts Institute of Technology".

    Erstellt: 2010-01

  • Tromelin Island
  • Tromelin Island (W3)

    Der Name der engl. "Tromelin Island" geht zurück auf den "Chevalier de Tromelin", engl. "Knight of Tromelin", einem französischen königlichen Marineoffizier und Kapitän der Korvette "La Dauphine", der die Insel im Jahr 1776 besuchte.

    (E?)(L1) http://www.nationmaster.com/country/te-tromelin-island
    (E?)(L1) http://earth-info.nga.mil/gns/html/cntyfile/te.zip
    (E?)(L?) http://en.wikipedia.org/wiki/Tromelin_Island
    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    (E?)(L?) http://en.wikipedia.org/wiki/French_Navy


    Erstellt: 2010-01

  • Kuwait
  • Al Kuwayt
  • Kuwait
    Al Kuwayt (W3)

    Der Name des Landes "Kuwait" geht zurück auf die Verkleinerungsform von arab. "Kut", "Kout" = "Festung am Wasser".

    (E?)(L?) http://www.nationsonline.org/oneworld/kuwait.htm
    (E?)(L1) http://earth-info.nga.mil/gns/html/cntyfile/ku.zip
    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies


    Erstellt: 2010-01

  • Country Files (nga)
  • nga
    Country Files

    (E?)(L1) http://earth-info.nga.mil/gns/html/namefiles.htm
    Complete Files of Geographic Names for Geopolitical Areas from GNS (ISO/IEC 10646 [Unicode UTF-8] Compliant as of 18 July 2002)

    Erstellt: 2010-01

  • Europa Island
  • Europa Island (W3)

    Die zu Frankreich gehörende "Europa Island" wurde nach dem britischen Schiff "Europa" benannt, mit dem die Insel im Jahr 1774 angelaufen wurde.

    (E?)(L1) http://earth-info.nga.mil/gns/html/cntyfile/eu.zip
    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies


    Erstellt: 2010-??

  • No Man's Land
  • No Man's Land (W3)



    (E?)(L1) http://earth-info.nga.mil/gns/html/cntyfile/nm.zip


    Erstellt: 2010-01

  • Semiothisa
  • Semiothisa (W3)



    (E?)(L?) http://www.bloobook.net/index/lepidoptera.php?lg=
    Reich Tiere > Stamm Gliederfüssler > Klasse Insekten > Ordnung Schmetterlinge > Familie Spanner

    (E4)(L1) http://www.insektenbox.de/schmet/semalt.htm
    Semiothisa alternaria

    (E?)(L?) http://www.bloobook.net/browse/lepidoptera.php?lg=de&q=Semiothisa&level=6
    Semiothisa clathrata

    (E?)(L?) http://www.bloobook.net/browse/lepidoptera.php?lg=de&q=Semiothisa_wauaria
    Semiothisa wauaria

    (E?)(L?) http://www.funet.fi/pub/sci/bio/life/insecta/lepidoptera/ditrysia/geometroidea/geometridae/ennominae/semiothisa/index.html
    Semiothisa Hübner, 1818
    ...


    (E?)(L?) http://www.funet.fi/pub/sci/bio/life/warp/lepidoptera-12-English-list.html#semiothisa
    Semiothisa

    (E?)(L?) http://zipcodezoo.com/Key/Animalia/Semiothisa_Genus.asp


  • glass
  • glass (W3)



    (E?)(L?) http://1st-glass.1st-things.com/


  • cubiculum
  • cubiculum (W3)

    Lat. "cubiculum" der "Schlafzimmer" geht zurück auf lat. "cubile" = "Liege".

    Erstellt: 2010-01

  • ubiquitous
  • ubiquitous (W3)

    Engl. "ubiquitous" = "allgegenwärtig", "überall" geht zurück auf lat. "ubique" = dt. "überall".

    Erstellt: 2010-01

  • ca.
  • circa
  • ca.
    circa (W3)

    "ca." ist die Abkürzung von "circa", und dieses wurde direkt von lat. "circa" = "um ... herum" übernommen.

    Erstellt: 2010-01

  • Humus
  • Humus (W3)

    Dt. "Humus" kommt direkt von lat. "humus" = "Erde", "Boden".

    Erstellt: 2010-01

  • inhalieren
  • inhalieren (W3)

    Dt. "inhalieren" geht zurück auf lat. "inhalare" = "einatmen".

    Erstellt: 2010-01

  • Das ist drin in Lebensmitteln (das-ist-drin)
  • das-ist-drin
    Das ist drin in Lebensmitteln

    (E?)(L?) http://www.das-ist-drin.de/
    E-Nummern-Check, Siegeldatenbank, Betriebsnummernuebersicht ...

    Erstellt: 2010-01

  • Uncyclopedia (uncyclopedia)
  • Satirische Enzyklopaedie (uncyclopedia)
  • uncyclopedia
    Uncyclopedia
    Satirische Enzyklopaedie

    (E?)(L?) http://de.uncyclopedia.org/


    Erstellt: 2010-01

  • Digitalkamera-Magazin (dkamera)
  • dkamera
    Digitalkamera-Magazin

    (E?)(L?) http://www.dkamera.de/
    Datenblätter, Testberichte

    Erstellt: 2010-01

  • Dialoge zwischen Mann und Frau (kopfschuettel)
  • kopfschuettel
    Blog mit Dialogen zwischen Mann und Frau

    (E?)(L?) http://www.kopfschuettel.de/


    Erstellt: 2010-01

  • to wait with bated breath
  • to wait with bated breath (W3)

    Engl. "to wait with bated breath" = dt. "mit Spannung, angehaltenem Atem erwarten", enthält engl. "abate" = dt. "vermindern", "verringern", das zu "bate" bzw. "bated" verkürzt wurde. Auch diese Redewendung findet man zuerst bei William Shakespeare, in seinem Werk "Merchant of Venice" aus dem Jahr 1596.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-25


    Erstellt: 2010-01

  • (pcwelt)
  • pcwelt

    (E?)(L?) http://www.pcwelt.de/start/software_os/wissen_lernen/news/176578/diese_menschen_schufen_unsere_technik/index.html
    Zeitreise
    Diese Menschen schufen unsere Technik

    Computer und Multimedia sind heutzutage für viele selbstverständlich. Aber wer steckt eigentlich dahinter? Welchen Menschen haben wir die großen und kleinen Meilensteine der Technik zu verdanken? Wer steht hinter der Software, die wir täglich verwenden? In unserer Bildergalerie können Sie eine Reise durch die Welt der Technik machen.

    Bill Gates kennt jeder, aber wer ist Grace Hopper? Technik fasziniert uns täglich. Aber dass es sie in der heutigen Form gibt, ist keinesfalls selbstverständlich. Hinter jedem Stück Technik, hinter jeder Software und hinter jeder neuen Idee stecken letztlich Menschen. Oft war es nur eine kleine Idee, deren mutige Umsetzung die Welt der Technik bahnbrechend verändert hat. Manchmal war es auch die Genialität oder einfach nur die Geschäftstüchtigkeit Einzelner. Alles zusammen hat jedenfalls dazu geführt, dass in der heutigen Zeit technische Errungenschaften normaler Bestandteil unserer Arbeit und unseres Alltags geworden sind, von denen man noch vor einiger Zeit bestenfalls träumen konnte.

    Lehnen Sie sich zurück und begeben Sie sich auf eine faszinierende Reise durch die personalisierte Geschichte der Technik. Es gibt viel zu entdecken, denn viele Köpfe hinter der Technik Ihres Alltags werden Ihnen noch gar nicht bekannt sein. Hier kommt nicht nur der Erfinder des ersten Computers der Welt an die Reihe, sondern auch viele andere interessante Menschen, die kleine und große technische Raffinessen auf den Weg gebracht haben.

    Es fehlt jemand? Natürlich bildet unsere Bildergalerie nur einen Querschnitt der Menschen ab, deren Erfindungen oder Leistungen die Welt verändert haben. Wenn Sie jemanden kennen, der es Ihrer Meinung nach verdient hat, ebenfalls in unserer Liste zu erscheinen, dann schreiben Sie einfach seinen Namen und seine Leistungen ins Forum unter dieser Meldung.

    Die Köpfe hinter der Technik unserer Zeit
    Bild 1 von 78
    ...


    Erstellt: 2010-01

  • Alberta
  • Alberta (W3)

    Frz. "Alberta"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/alberta.htm


    Erstellt: 2010-??

  • Angleterre
  • Angleterre (W3)

    Frz. "Angleterre"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/europe/angleterre.htm


    Erstellt: 2010-??

  • Îles Anglo-Normandes
  • Îles Anglo-Normandes (W3)

    Frz. "Îles Anglo-Normandes"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/Europe/ilesanglo.htm


    Erstellt: 2010-??

  • Basse-Saxe
  • Basse-Saxe (W3)

    Frz. "Basse-Saxe"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/basse-saxe.htm


    Erstellt: 2010-??

  • Brandebourg
  • Brandebourg (W3)

    Frz. "Brandebourg"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/brandebourg.htm


    Erstellt: 2010-??

  • Bruxelles-Capitale
  • Bruxelles-Capitale (W3)

    Frz. "Bruxelles-Capitale"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/bruxelles-capitale.htm


    Erstellt: 2010-??

  • Chine
  • Chine (W3)

    Frz. "Chine"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/asie/chine.htm


    Erstellt: 2010-??

  • Christmas
  • Christmas (W3)

    Frz. "Christmas"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/pacifique/christmas-ile.htm


    Erstellt: 2010-??

  • Colombie-Britannique
  • Colombie-Britannique (W3)

    Frz. "Colombie-Britannique"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/colombiebrit.htm


    Erstellt: 2010-??

  • Corse
  • Corse (W3)

    Frz. "Corse"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/Europe/corsefra.htm


    Erstellt: 2010-??

  • Crimée
  • Crimée (W3)

    Frz. "Crimée", Ukraine,

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/crimee.htm


    Erstellt: 2010-??

  • Écosse
  • Écosse (W3)

    Frz. "Écosse"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/Europe/ecosse.htm


    Erstellt: 2010-??

  • DOM-TOM
  • DOM-TOM (W3)

    Frz. "DOM-TOM"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/francophonie/dom-tom.htm


    Erstellt: 2010-??

  • Gagaouzie
  • Gagaouzie (W3)

    Frz. "Gagaouzie"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/gagaouzie.htm
    (gagaouze-moldave-russe)

    Erstellt: 2010-??

  • Hong-Kong
  • Hong-Kong (W3)

    Frz. "Hong-Kong"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/asie/Hong-Kong.htm


    Erstellt: 2010-??

  • Île-du-Prince-Édouard
  • Île-du-Prince-Édouard (W3)

    Frz. "Île-du-Prince-Édouard"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/ilepe.htm


    Erstellt: 2010-??

  • Kurdistan (W3)

    Frz. "Kurdistan"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/asie/kurdistan.htm


    Erstellt: 2010-??

  • Manitoba
  • Manitoba (W3)

    Frz. "Manitoba"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/manitoba.htm


    Erstellt: 2010-??

  • Moldavie
  • Moldavie (W3)

    Frz. "Moldavie"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/europe/moldavie.htm
    (moldave/roumain)

    Erstellt: 2010-??

  • Nevada
  • Nevada (W3)

    Frz. "Nevada"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/nevada.htm


    Erstellt: 2010-??

  • Nouveau-Brunswick
  • Nouveau-Brunswick (W3)

    Frz. "Nouveau-Brunswick"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/nbrunswick.htm


    Erstellt: 2010-??

  • Nouvelle-Écosse
  • Nouvelle-Écosse (W3)

    Frz. "Nouvelle-Écosse"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/necosse.htm


    Erstellt: 2010-??

  • Nunavut
  • Nunavut (W3)

    Frz. "Nunavut"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/nunavut.htm
    (anglais, français, inuktitut, inuinnaqtun)

    Erstellt: 2010-??

  • Ontario
  • Ontario (W3)

    Frz. "Ontario"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/ontario.htm


    Erstellt: 2010-??

  • Pays de Galles
  • Pays de Galles (W3)

    Frz. "Pays de Galles"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/europe/paysgalles.htm
    (anglais-gallois)

    Erstellt: 2010-??

  • Pondichéry
  • Pondichéry (W3)

    Frz. "Pondichéry"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/asie/inde-pondicherry.htm
    (tamoul-français, télougou-anglais, malayalam-anglais)

    Erstellt: 2010-??

  • Québec
  • Québec (W3)

    Frz. "Québec"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/quebecacc.htm


    Erstellt: 2010-??

  • Saint-Barthélemy
  • Saint-Barthélemy (W3)

    Frz. "Saint-Barthélemy"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amsudant/st-barth.htm


    Erstellt: 2010-??

  • Sint Maarten
  • Sint Maarten (W3)

    Frz. "Sint Maarten"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amsudant/St-Maarten_PB.htm


    Erstellt: 2010-??

  • Saskatchewan
  • Saskatchewan (W3)

    Frz. "Saskatchewan"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/saskatchewan.htm


    Erstellt: 2010-??

  • Saxe
  • Saxe (W3)

    Frz. "Saxe"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/saxe.htm


    Erstellt: 2010-??

  • Schleswig-Holstein
  • Schleswig-Holstein (W3)

    Frz. "Schleswig-Holstein"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/schleswig-holstein.htm


    Erstellt: 2010-??

  • Terre-Neuve
  • Terre-Neuve (W3)

    Frz. "Terre-Neuve"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/terreneuve.htm


    Erstellt: 2010-??

  • Territoires du Nord-Ouest
  • Territoires du Nord-Ouest (W3)

    Frz. "Territoires du Nord-Ouest"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/tno.htm


    Erstellt: 2010-??

  • Transnistrie
  • Transnistrie (W3)

    Frz. "Transnistrie"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/EtatsNsouverains/Transnistrie.htm
    (russe-moldave-ukrainien)

    Erstellt: 2010-??

  • Yukon
  • Yukon (W3)

    Frz. "Yukon"

    (E?)(L?) http://www.tlfq.ulaval.ca/axl/amnord/yukon.htm


    Erstellt: 2010-??

  • schlingen
  • schlingen (W3)

    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/paulka16.htm
    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/Druckversion_paulka16.htm
    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=4668&kapitel=13&cHash=85ec91658a2#gb_found
    ...
    "schlingen" ("devorare") ist mitteldeutsche Form für älteres "slinden" (vgl. "schlund") und hat sich vielleicht deshalb in der Schriftsprache festgesetzt, weil es mit "schlingen" = mhd. "slingen" verschmolzen ist.
    ...


    Erstellt: 2010-01

  • Schanze
  • in die Schanze schlagen
  • Schanze
    in die Schanze schlagen (W3)

    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/paulka16.htm
    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/Druckversion_paulka16.htm
    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=4668&kapitel=13&cHash=85ec91658a2#gb_found
    ...
    Bei der Wendung "in die Schanze schlagen" denkt man kaum daran, dass man es mit einem andern Worte als dem gewöhnlichen "Schanze" zu tun hat; es ist franz. "chance".
    ...


    Erstellt: 2010-01

  • Statt
  • Statt (W3)

    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/paulka16.htm
    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/Druckversion_paulka16.htm
    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=4668&kapitel=13&cHash=85ec91658a2#gb_found
    ...
    Über die Mischung von mhd. "stat" und "state" in nhd. "Statt" vgl. mein Wörterbuch.
    ...


    Erstellt: 2010-01

  • laden
  • laden (W3)

    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/paulka16.htm
    (E1)(L1) http://gutenberg.spiegel.de/paulh/prinzip/Druckversion_paulka16.htm
    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=4668&kapitel=13&cHash=85ec91658a2#gb_found
    ...
    Schon weniger fraglich ist es, dass der Übertritt von "laden" ("einladen") (= ahd. "ladôn") in die starke Konjugation durch "laden" ("aufladen") (ahd. "hladan") veranlasst ist; umgekehrt kommen von letzterem auch schwache Formen vor, z. B. "überladete" bei Less., "ladest", "ladet" auch jetzt.

    Sicher ist, dass ein starkes er "befährt" bei Jean Paul zu dem sonst schwachen "befahren" = mhd. "vâren" durch Verwechselung mit dem starken "befahren" (mhd. "varn") veranlasst ist.

    In Österreich verwechselt man "kennen" und "können", man sagt z. B.: der Schauspieler hat seine Rolle nicht "gekannt". In dem letzten Falle sind zwar etymologisch verwandte, aber doch wesentlich verschiedene Wörter konfundiert.

    Im Ahd. sind die Präpositionen "int-" und in "in" der Komposition mit einem Verbum vielfach in die Form "in-" zusammengeflossen, indem das "t" durch Assimilation in den folgenden Konsonanten aufgegangen ist. Die Doppelheit "int-" - "in-" ist dann auch auf solche Fälle übergegangen, in denen "in" zu Grunde liegt, vgl. nhd. "entbrennen", "entzünden" etc.

    Unser "zer" hatte früher eine Nebenform "ze-" ("zer-" vor Vokal, "ze-" vor Konsonant entwickelt). Diese war lautidentisch mit der ihrem Ursprunge nach ganz verschiedenen Präposition "ze" "zu". Neben diese trat im Mhd. die Adverbialform "zuo", nhd. "zu", welche allmählich die Form "ze" ganz verdrängt hat. Dies "zu" finden wir nun auch für "ze-" = "zer-", z. B. bei Luther. Entsprechend ist ags. "tô-" in der Bedeutung von "zer-" zu erklären.

    Lat. "præstare" ist in dem Sinne "leisten" eine Ableitung aus "*præstus" (erhalten nur in dem Adv. "præsto") und sollte daher regelmässig flektiert werden; das Perf. "præstiti" beweisst die Vermischung mit "præ-stare" = "voranstehen".
    ...


    Erstellt: 2010-01

  • to win at a canter
  • to win at a canter (W3)

    Engl. "to win at a canter" = dt. "mühelos gewinnen", lautet in voller Länge "at a Canterbury pace, rate or trot" = "Im Canterbury-Tempo, Schritt oder Trab". Dies spielt darauf an, dass die Pilger, die sich auf dem Pferd auf den Weg zum Grab des Thomas Becket, dem 1170 ermordeten Erzbischof von Canterbury, machten, nur langsam ritten. Hierauf geht auch das Verb engl. ""to canter" = "langsam reiten" zurück.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-26


    Erstellt: 2010-02

  • to wash one's dirty linen in public
  • to wash one's dirty linen in public (W3)

    Engl. "to wash one's dirty linen in public" = dt. "seine schmutzige Wäsche in der Öffentlichkeit waschen", soll auf Napoleon zurück gehen. Nach seiner Rückkehr aus dem Exil auf Elba im Jahr 1815 soll er in einer Rede gesagt haben: "It is at home, not in public, that one washes one's dirty linen."

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-27


    Erstellt: 2010-02

  • Was interessiert mich mein Geschwätz von gestern
  • Was interessiert mich mein Geschwätz von gestern (W3)

    War Konrad Adenauer wirklich der erste, der sich nicht für sein Geschwätz von gestern interessierte? Immerhin konnte er diese Aussage ins Positive kehren indem er ergänzte: "Nichts hindert mich, weiser zu werden." - eine Zugabe, die viele anderen vergessen.

    Erstellt: 2010-??

  • Voynich-Manuskript
  • Voynich-Manuskript (W3)



    (E?)(L?) http://www.heise.de/tp/r4/artikel/31/31971/1.html
    Neue Datierung des Voynich-Manuskripts sorgt für Aufsehen (Klaus Schmeh)
    Die Frage nach dem Alter des rätselhaften Voynich-Manuskripts ist endlich geklärt


    Erstellt: 2010-02

  • Fotos von Charles Cramer (charlescramer)
  • charlescramer
    Fotos von Charles Cramer

    (E?)(L?) http://www.charlescramer.com/


    Erstellt: 2010-??

  • Etymologie-Suche (izito)
  • Etymology-Search (izito)
  • izito
    Etymologie-Suche
    Etymology-Search

    (E?)(L?) http://www.izito.de/
    (E?)(L?) http://www.izito.de/?q=Etymologie
    (E?)(L?) http://www.izito.de/?q=Etymology


    Erstellt: 2010-??

  • Pyrrhic victory
  • Pyrrhic victory (W3)

    Engl. "Pyrrhic victory" = dt. "Pyrrhussieg", "Scheinsieg", geht zurück auf die griechische Mythologi. "Pyrrhus" der König des im Westen Griechenland liegenden Epirus, konnte sich erfolgreich gegen die Römer wehren. Während des Kriegs (-280 - -279) erlitt seine Armee jedoch große Verluste, so daß Pyrrhus nach der Schlacht sagte: "Noch so ein Sieg und ich komme allein nach Epirus zurück". Heute kann man in allen Lebensbereichen "Pyrrhussiege" erringen.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-01


    Erstellt: 2010-02

  • to be as snug as a bug in a rug
  • to be as snug as a bug in a rug (W3)

    Engl. "to be as snug as a bug in a rug" = dt. "sich rundum wohlfühlen, wie die Made im Speck leben", geht zurück auf Benjamin Franklin. Er wollte der Tochter von Freunden ein Eichhörnchen namens "Skugg" schenken. Dieses entkam jedoch und wurde getötet. Vermutlich um das Mädchen nicht mit der bitteren Wahrheit zu konfrontieren schrieb Franklin im Jahr 1772: "Here Skugg lies snug, as a bug in a rug.", wörtlich dt. "Hier liegt Skugg, bequem wie eine Wanze im Teppich." Die deutsche Entsprechung ist etwa "wie die Made im Speck".

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-28


    Erstellt: 2010-02

  • Fernseh-Informationen (quotenmeter)
  • quotenmeter
    Fernseh-Informationen
    Serien und Sendungen

    (E?)(L?) http://www.quotenmeter.de/


    Erstellt: 2010-02

  • Fotografie-Informationen (fokussiert)
  • fokussiert
    Fotografie-Informationen

    Kameras, Nachtfotografie, HDR-Aufnahmen, Infrarotfotografie, DSLR, ...

    (E?)(L?) http://www.fokussiert.com/


    Erstellt: 2010-02

  • to soft-pedal
  • to soft-pedal (W3)

    Engl. "to soft-pedal" = dt. "herunterspielen", spielt an auf das engl. "soft pedal" beim Klavier, um die Lautstärke zu dämpfen.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-01-29


    Erstellt: 2010-02

  • Websitewiki (wikia)
  • wikia
    Websitewiki

    (E?)(L?) http://websitewiki.wikia.com/
    Das WebsiteWiki ist ein Wiki über Websites. Jeder kann hier eine Website kommentieren oder beschreiben. Jeder, der zu einer Website etwas zu berichten hat, ist willkommen.

    Seit Februar 2007 sind hier bereits 1.245.291 Artikel über Websites angelegt worden, was WebsiteWiki zum größten deutschsprachigen Wiki macht.


    (E?)(L?) http://websitewiki.wikia.com/Spezial:Suche?search=Etymologie&go=1
    (E?)(L?) http://websitewiki.wikia.com/Spezial:Suche?search=Etymology&go=1
    Leider ergab weder die Suche nach "Etymologie" noch nach "Etymology" einen Treffer.

    (E?)(L?) http://websitewiki.wikia.com/Kategorie:Hauptkategorie
    Kategorien



    (E?)(L?) http://websitewiki.wikia.com/Kategorie:Bildung
    Seiten in der Kategorie „Bildung“: Es werden insgesamt 274 Seiten in dieser Kategorie angezeigt:



    (E?)(L?) http://websitewiki.wikia.com/Kategorie:Personen
    Seiten in der Kategorie „Personen“: Es werden insgesamt 112 Seiten in dieser Kategorie angezeigt:



    (E?)(L?) http://websitewiki.wikia.com/Kategorie:Wissenschaft
    Seiten in der Kategorie „Wissenschaft“: Es werden insgesamt 324 Seiten in dieser Kategorie angezeigt:



    Erstellt: 2010-01

  • IPv6
  • IPv6 (W3)



    (E?)(L?) http://www.heise.de/newsticker/meldung/RFC-beschreibt-schnelle-IPv6-Einfuehrung-912286.html
    RFC beschreibt schnelle IPv6-Einführung

    Bereits Ende 2007 hatte der französische Provider Free seinen 1,5 Millionen Breitbandkunden das Angebot gemacht, auch über IPv6 kommunizieren zu können. Dabei setzt er auf ein vom Rémi Després entwickeltes Verfahren namens "IPv6 Rapid Deployment in IPv4 Infrastructures" (6RD), das die IETF am gestrigen Sonntag als RFC 5569 veröffentlicht hat.
    ...


    Erstellt: 2010-??

  • Online-Magazin für Männer (asylum)
  • asylum
    Online-Magazin für Männer

    (E?)(L?) http://de.asylum.com/


    Erstellt: 2010-01

  • Online-Magazin für Männer (asylum)
  • asylum
    Online-Magazin für Männer

    (E?)(L?) http://www.asylum.com/


    Erstellt: 2010-01

    (E?)(L?) http:///
    Nanjing ("de jure")
    (E?)(L?) http:///
    Taipeh ("de facto")

    - Nanjing: "Südliche Hauptstadt"
    - Taipeh: (auch Taipei; chin. Kurzzeichen: å°åŒ— / Langzeichen: 臺北 TáibÄ›i) liegt im Norden (北 bÄ›i) der Insel Taiwan (å°ç£ Taiwan, Kurzform: å° tái).

    (E?)(L?) http:///
    Ljubljana Für den Namen der Stadt Ljubljana (deutsch Laibach) gibt es drei verschiedene Wege, die Herkunft des Namens zu erklären. Entweder kommt der Name von ljubljena ("geliebt"), oder vom lateinischen Flussnamen aluviana, eine andere Möglichkeit wäre eine schlichte Ableitung aus dem deutschen Laubach (heute Laibach).

  • Tunis
  • Tunis (W3)



    (E?)(L?) http://de.wikipedia.org/wiki/Tunis


    (arabisch: Tunis تونس ) geht vielleicht auf das alte Wort "tunus" ("die Nacht verbringen") zurück.

    (E?)(L?) http:///
    Kiew Laut Nestorchronik wurde Kiew von drei Brüdern namens Kyj, Schtschek und Choriw gegründet und nach dem ältesten Bruder benannt ("Kiew" = 'Stadt von Kyj', altrussisch und ukrainisch: Kyjiw). Dies soll spätestens am Anfang des 6. Jahrhunderts geschehen sein, da der Name des slawischen Fürsten Kyj in dieser Zeit in byzantinischen Chroniken erwähnt wurde. Einige mittelalterliche Quellen führen die Gründung Kiews auf die Jahre 430-460 zurück. Es gibt auch Spekulationen, die Kiew schon mit der von Jordanes erwähnten großen gotischen Stadt Danapirstadir (= "Stadt am Dnepr") identifizieren.

    (E?)(L?) http:///
    Arabic Nimsa: Presumably from the Slavic word nowaday used for Germany, via Turkish.
  • Czech Rakousko (country) or Rakousy (Upper and Lower Austria): from Rakous (German: Raabs), an important fortress on the Moravian-Austrian border.
  • Finnish Itävalta
  • (E?)(L?) http:///

    Caroline Islands

    Named after Charles II, who reigned as king of Spain from 1665 to 1700. (E?)(L?) http:///

    Flag of Catalonia Catalonia:

    Catalunya in Catalan. The origin is unclear and there are a lot of hypotheses. Perhaps from the word meaning "land of castles" (see Castile for a similar origin). According to another but somewhat similar theory (Lafont 1986), Catalunya could come from Arabic Qalat-uniyya (Qalat means "castle" and -uniyya is a collective suffix) because medieval Catalonha used to be a frontier country whith a lot of castles in front of the Muslim and Arabized zone of the Iberic peninsula. Some texts suggest that the name Catalunya derives from "Gauta-landia": Land of the Goths, or "Goth-Alania" meaning "Land of the Goths and Alans" through Arabian *Cotelanuyya [cf. Andalusia, land of the Vandals], as the Visigoths and Alans invaded and divided Iberia between themselves, agreeing to rule some parts together, with the region of Catalunya going to the Visigoths. Additionally, the Visigothic kingdom of Catalonia may have been named after the original homeland of the Visigoths, "Gotland". Coromines suggests an Iberian origin: Laietani (latinization of Iberian laiezken) > *laketani > laketans > metathesized as catelans > catalans, reforced by castellani (with an epenthetic s according to Coromines). Another theory suggests *kaste-lan as the Iberian name later latinized as castellani (an Iberian tribe in northern Catalonia according to Ptolemy); then the name would have evolved into *catellani > *catelans > *catalans. (E?)(L?) http:///

    Flag of Chechnya Chechnya:

    The Russian ethnonym Chechen probably derives from the name of the ancient village of Chechana or Chechen-aul. The village is situated on the bank of the Argun River, near Grozny. Another theory derives the name from chechenit' sya "to talk mincingly.[4]
    The native term, Noxçi, is derived from nexça (sheep cheese), nox (plow) or from the prophet Noah (Nox in Chechen) (E?)(L?) http:///

    Flag of Dagestan Dagestan:

    The word Daghestan or Daghistan (Avar: ДагъиÑтан; Arabic and Persian: داغستان) means "country of mountains", it is derived from the Turkic word daÄŸ meaning mountain and Persian suffix -stan meaning "land of". The spelling Dagestan is a transliteration from Russian language, which lacks the voiced velar fricative. (E?)(L?) http:///
  • Chud (Old East Slavic): originally derived from the Gothic for "people" (see "Deutschland" under the heading "Germany"); more recent folk-etymology has also linked the name to the Slavic root for "weird". Lake Peipus still bears the name of "Chudskoe Lake" in Slavic languages.
  • Igaunija (Latvian): from the ancient Ugaunian tribe in southeastern Estonia.
  • Viro (Finnish variant): from the ancient Vironian tribe in northern Estonia.
  • Friagi or Friaz' in Old Russian: from the Byzantine appellation for the medieval Franks.
  • Valland (variant in Icelandic): land of "valer", (an Old Norse name for Celts, later also used for the Romanized tribes).
  • WÅ‚ochy (Polish) and Olaszország (Hungarian): from Gothic walh, the same root as in Valland, see details under "Wallachia" below.
  • (E?)(L?) http:///

    Flag of Occitania Occitania:

    Occitània in Occitan. From medieval Latin Occitania (approximately since 1300). The first part of the name, Occ-, comes from Occitan [lenga d']òc or Italian [lingua d']oc (i.e. "Language of Òc"), a name given to the Occitan language by Dante according to its way of saying "yes" (òc). The ending -itania is probably an imitation of the old Latin name [Aqu]itania.
    See also: origin of the term Slav (E?)(L?) http://en.wikipedia.org/wiki/Tajiks
    (E?)(L?) http://en.wikipedia.org/wiki/Persian_people
    (E?)(L?) http://en.wikipedia.org/wiki/Persian_language
    (E?)(L?) http://en.wikipedia.org/wiki/Tibet
    (E?)(L?) http://en.wikipedia.org/wiki/Tiger
    (E?)(L?) http://en.wikipedia.org/wiki/Leopard
    (E?)(L?) http://en.wikipedia.org/wiki/-stan
    "Tajikistan" or "Tojikiston" (alternative name) means "land of the Tajiks", with "Tajik" being an alternative name of the Persians. Tajikistan is the only country from all of Soviet Union Commonwealth which is persian speaking and its history goes back to Persian Empire. The root word "Toj" is derived from Persian language meaning "crown". Because of the influence of Russians during the Soviet period, the root word "Toj" changed slightly and by the time the word became "tojik". Literally meaning of "Tajikistan" is "place where people have crowns." Another possible root is the Tibetans call all Persians "Tag Dzig" (Pronounced "Tajik") but in Tibetan this also means "tiger-leopard". This could explain why so many Tibetan legends about their western neighbours feature tiger/leopard combinations. The suffix "-stan", from Persian, means "land".

    Flag of Yugoslavia Yugoslavia (former name):

    From "Jugoslavija", which means "Land of the South Slavs" (South Slavic jug means in English south). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    This list covers English language country names with their etymologies. Some of these include notes on indigenous names and their etymologies. Countries in italics no longer exist as sovereign political entities.

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Afghanistan: Main article: Origins of the name Afghanistan "Land of Afghans," Afghan from the Sanskrit tribal name Asvaka meaning "horseman", as the country was noted for its fine breed of horses; and the Persian suffix -stan meaning "land of". Said tribal name Asvaka was apparently used in reference to the Kambojas in antiquity. The Arabic Afgan is an adaptation of the Prakrit form Avagana as first used by Varahamihira in his B?hat Sa?hita in the 6th century CE. Since the Middle Ages, "Afghan" has been used as a synonym for Pashtun. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Åland (autonomous province of Finland): "Land [in the] water," from the Germanic root *ahw-, cognate with Latin aqua. The Finnish name Ahvenanmaa is partly borrowed, partly translated from Germanic. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Albania: From medieval Greek "??ßa??a" (Albania).[1] "Alb" from the Proto-Indo-European root meaning "white" or "mountain", as mountains are often white-capped with snow; compare Alps. Albanian: Shqipëria (Land of the Eagles), or Arbëri (poetic and archaic) (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Algeria: The name Algeria is derived from the name of the city of Algiers (French Alger), from the Arabic word "???????" (al-gaza'ir), which translates as the islands, referring to the four islands which lay off that city's coast until becoming part of the mainland in 1525; al-gaza'ir is itself short for the older name gaza'ir bani mazganna, "the islands of (the tribe) Bani Mazghanna", used by early medieval geographers such as al-Idrisi and Yaqut al-Hamawi. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    American Samoa (territory of the United States of America): See Samoa and United States of America below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Andorra: Etymology unknown and contested; of pre-Roman, possibly Iberian or Basque origin. The name Andorra might be derived from al-Darra, the Arabic word for forest. When the Moors invaded Spain, the valleys of the Pyrenees were especially wooded, and the title Andorra can be found linked to villages in other parts of Spain which had been under Moorish domination. Still others claim that it comes from the Spanish andar, meaning "to walk", which gave name to the nomadic tribe of Andorrisoe which ostensibly migrated to the valleys in and around present-day Andorra, or could possibly originate from a Navarrese word andurrial, which translates as "shrub-covered land." An oft-told legend is that the name came from the archaic "Endor", which Louis le Debonnaire christened what he referred to as the "wild valleys of Hell" after defeating the Moors – wild and desolate mountain ranges have been associated with the Devil throughout much European literature. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Angola: From Ngola, a title used by the monarch of the Kingdom of Ndongo. The Portuguese named the area in honour of a Ngola allied with them. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Anguilla (overseas territory of the United Kingdom): From the word for "eel" in any of several Romance languages (Spanish: anguila; French: anguille; Italian: anguilla), due to its elongated shape. The circumstances of the island's European discovery and naming are uncertain: Christopher Columbus (1493) or French explorers (1564) are both possibilities.[2] (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Antigua and Barbuda: Christopher Columbus named Antigua in honour of the Santa María La Antigua ("Saint Mary the Old") cathedral in Seville, Spain, when he landed there in 1493. "Barbuda" means "bearded" in Portuguese. The islands gained this name after the appearance of the their fig trees, whose long roots resemble beards. Alternatively, it may refer to the beards of the indigenous people. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Argentina: Main article: Origin and history of the name of Argentina From the Latin argentum, meaning "silver". Early Spanish and Portuguese traders used the region's Río de la Plata or "Silver River" to transport silver and other treasures from Peru to the Atlantic. The land around the terminal downstream stations became known as La Argentina – "The Land of Silver". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Armenia: Main article: Armenia (name) From Old Persian Armina (6th century BC), Greek Armenia (5th century BC). The further etymology of the Persian name is uncertain, but may be connected to the Assyrian Armânum, Armanî and/or the Biblical Minni. The Old Persian name is an exonym, see Hayk for the native name and Urartu for the Biblical Ararat. Armenian: ???????? Hayastan (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Aruba (territory of Netherlands): Two possible meanings exist. One story relates how the Spanish explorer Alonso de Ojeda named the island in 1499 as "Oro Hubo", implying the presence of gold (oro hubo in Spanish means "there was gold"). Another possible derivation cites the Arawak Indian word oibubai, which means "guide". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Australia: Originally from Latin terra australis incognita — "unknown southern land". Early European explorers, sensing that the Australian landmass far exceeded in size what they had already mapped, gave the area a generic descriptive name. The explorer Matthew Flinders (1774 – 1814), the first to sail around and chart the Australian coast, used the term "Australia" in his 1814 publication A Voyage to Terra Australis. Previous Dutch explorers had referred to the continent as Australisch and as "Hollandia Nova" (New Holland). From the introduction in Flinders' book: "There is no probability, that any other detached body of land, of nearly equal extent, will ever be found in a more southern latitude; the name Terra Australis will, therefore, remain descriptive of the geographical importance of this country, and of its situation on the globe: it has antiquity to recommend it; and, having no reference to either of the two claiming nations, appears to be less objectionable than any other which could have been selected.*"[3] ...with the accompanying note at the bottom of the page: "* Had I permitted myself any innovation upon the original term, it would have been to convert it into AUSTRALIA; as being more agreeable to the ear, and an assimilation to the names of the other great portions of the earth."[3] Note: Antarctica, which is south of Australia, would be discovered in 1820, although who first saw it in that year is a matter of dispute. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Austria: Compare the modern German Österreich, from Old High German ôstarrîhhi, which literally means "empire in the East." In the 9th century, the territory formed part of the Frankish Empire's eastern limit, and also formed the eastern limit of German settlement bordering on Slavic areas. Under Charlemagne and during the early Middle Ages, the territory had the Latin name marchia orientalis (Eastern March). This translated to Ostarrîchi in the vernacular of the time; that Old High German form first appears in a 996 document. Arabic Nimsa: Presumably from the Slavic word nowaday used for Germany, via Turkish. Czech Rakousko (country) or Rakousy (Upper and Lower Austria): from Rakous (German: Raabs), an important fortress on the Moravian-Austrian border. Finnish Itävalta (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Azerbaijan: Main article: History of the name Azerbaijan Native spelling Az?rbaycan (from surface fires on ancient oil pools; its ancient name, (Media) Atropatene (in Greek and Latin) or Atrpatakan (in Armenian), actually referring to the present-day Azerbaijan region of Iran. The name became Azerbaijan in Arabic. The Persians knew the territory of the modern republic of Azerbaijan as "Aran"; and in classical times it became "(Caucasian) Albania" and, in part, "(Caucasian) Iberia", although this last term corresponds mostly to the present-day republic of Georgia. (See Georgia below.) The region of Media Atropatene lay further to the south: south of the River Araxes. "Aran" may derive from the same root as modern "Iran", while "Albania" and "Iberia" appear as toponyms of Caucasus mountain derivation. The name "(Media) Atropatene" comes from Atropates ("fire protector" in Middle Persian) who ruled as the independent Iranian satrap at the time of the Seleucids. The modern ethnonym 'Azerbaijani' has often become the subject of sharp differences of opinion between the ethnically Turkic inhabitants of the modern republic of Azerbaijan and the inhabitants of the Persian-dominated neighboring republic of Iran. Iranians regard the names "Azerbaijan" and "Atropatene" as expressions of historically Persian culture, and therefore often refer to the modern republic of Azerbaijan as "Turkish Azerbaijan", and to its inhabitants as "Azerbaijani Turks". In contrast, Turkophone Azerbaijanis insist on their own place as an historically continuous presence in Azerbaijani history. The suffix -an in Persian means "land". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bahamas: From Spanish Baja Mar – "Low (Shallow) Sea". The islands were named by the Spanish conquistadors after the waters around them. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Barbados: Named by the Portuguese explorer Pedro A. Campos "Os Barbados" ("The Bearded Ones") in 1536 after the appearance of the island's ficus trees, whose long roots resemble beards. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Belgium: From the name of a Celtic tribe, the Belgae. The name Belgae may derive from the Proto-Indo-European *bolg meaning "bag" or "womb" and indicating common descent; if so, it likely followed some unknown original adjective. Another theory suggests that the name Belgae may come from the Proto-Celtic *belo, which means "bright", and which relates to the English word bale (as in "bale-fire"), to the Anglo-Saxon bael, to the Lithuanian baltas, meaning "white" or "shining" (from which the Baltic takes its name) and to Slavic "belo/bilo/bjelo/..." meaning "white" (as in the town names Beograd, Biograd, Bjelovar, etc, all meaning "white city"; see Beltane). Thus the Gaulish god-names Belenos ("Bright one") and Belisama (probably the same divinity, originally from *belo-nos = "our shining one") might come also from the same source. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Belize: Traditionally said to derive from the Spanish pronunciation of "Wallace", the name of the pirate who set up the first settlement in Belize in 1638. Another possibility relates the name to the Maya word belix, meaning "muddy water", applied to the Belize River. British Honduras (former name): after the colonial ruler (Britain). For "Honduras" see Honduras below. See also Britain, below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bermuda (overseas territory of the United Kingdom): From the name of the Spanish sea captain Juan de Bermúdez who sighted the islands in 1503. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bhutan: The ethnic Tibetans or Bhotia migrated from Tibet to Bhutan in the 10th century. The root Bod is an ancient name for Tibet. Bhutanese language: Druk Yul — "land of the thunder dragon", "land of thunder", or "land of the dragon", from the violent thunder storms that come from the Himalayas. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bohemia (formerly independent western part of the Czech Republic): Latin and traditional English variant derive from the Celtic tribe known as as the Boii. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bolivia: Named after Simón Bolívar (1783–1830), an anti-Spanish militant and first president of Bolivia after the country gained its independence in 1825. His surname comes from La Puebla de Bolibar, a village in Biscay, Spain. The etymology of Bolibar may be bolu- ("mill") + -ibar ("river"). Thus, it might mean a mill on a river. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bosnia and Herzegovina: The country consists of two distinct regions. The larger northern section, Bosnia, takes its name from the Bosna river. The smaller, southern, territory, Herzegovina, takes its name from the German noble title Herzog, meaning "Duke". Frederick IV, King of the Romans, made the territory's ruler, the Grand Vojvoda Stjepan Vukcic, a duke in 1448. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Botswana: Named after the country's largest ethnic group, the Tswana. Bechuanaland (former name): derived from Bechuana, an alternative spelling of "Botswana". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bouvet Island (territory of Norway): Named after the French explorer Jean-Baptiste Charles Bouvet de Lozier, who discovered the remote island in 1739. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Brazil: Named after the brazilwood tree, called pau-brasil in Portuguese and so-named because its reddish wood resembled the color of red-hot embers (brasa in Portuguese), and because it was recognized as an excellent source of red dye. In Tupi it is called "ibirapitanga", which means literally "red wood". The wood of the tree was used to color clothes and fabrics. Another theory states that the name of the country is related to the Irish myth of Hy-Brazil, a phantom island similar to St. Brendan's Island, southwest of Ireland. The legend was so strong that during the 15th century many expeditions tried to find it, the most important being that of John Cabot. As the Brazilian lands were reached by Pedro Álvares Cabral in 1500 A.D., the Irish myth would have influenced the late name given to the country (after "Island of Real Cross" and "Land of Holy Cross"). The proof that the legend was popular among Iberic people may be verified by the name of the Azorean Terceira Island, registered in the 14th century in the Atlas Catalan and around 1436 on the Venetian map of Andrea Bianco.[clarification needed] See also list of Brazil state name etymologies. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Britain: From Pretani, "painted ones"[citation needed]; perhaps a reference to the use of body-paint and tattoos by early inhabitants of the islands; may also derive from the Celtic goddess Brigid[citation needed]. The form 'Britain' (see also Welsh Prydain) comes from Latin 'Britannia', probably via French. The former name of the island of Britain was Albion, an ancient Greek adaptation of a Celtic name which may survive as the Gaelic name of Scotland, Alba. Traditionally, a folk etymology derived the name from "Brutus", but this is almost certainly not the case. Brittany derives from the same root. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Bulgaria: Named after the Bulgars. It has been assumed that their tribal name, Bulgar, may come from burg, which means "castle" in Germanic languages; A. D. Keramopoulos derives the name "Bulgars" from burgarii or bourgarioi meaning "those who maintain the forts" (burgi, bourgoi, purgoi) along the northern boundaries of the Balkan provinces, and elsewhere in the Roman Empire, first mentioned in Greek in an inscription dated A.D. 202, found between Philippopolis and Tatar Pazardzhik (and last published in Wilhelm Dittenberger's Sylloge inscriptionum graecarum, 3 ed., vol. II [1917], no. 880,1. 51, p. 593). This interpretation, however, seems unlikely, seeing as the name "Bulgar" existed long before these people came in contact with the Indo-Germanic world. An alternative Turkic etymology for the name of the pre-Slavicised Central-Asian Bulgars derives from Bulgha meaning sable and has a totemistic origin. Some mistakenly associate the name Bulgar with the River Volga in present-day Russia, due to the fact that Bulgars lived in that region before and after the migration to the Balkans: see Volga Bulgaria. However, there is no linguistic association. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Burma: see Myanmar below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cambodia: The name "Cambodia" derives from that of the ancient Khmer kingdom of Kambuja (Kambujadesa). The ancient Sanskrit name Kambuja or Kamboja referred to an early Indo-Iranian tribe, the Kambojas, named after the founder of that tribe, Kambu Svayambhuva, apparently a variant of Cambyses, Kambujiya or Kamboja. See Etymology of Kamboja. Kampuchea (local name): derived in the same fashion. It also was the official English-language name from 1975 to 1989. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cameroon: From Portuguese Rio de Camarões ("River of Shrimps"), the name given to the Wouri River by Portuguese explorers in the 15th century. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Canada: Main article: Canada's name From the word Kanata meaning "village" or "settlement" in the Saint-Lawrence Iroquoian language spoken by the inhabitants of Stadacona and the neighbouring region, in the 16th century, near present-day Quebec City. See also Canadian provincial name etymologies. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Caroline Islands Named after Charles II, king of Spain from 1665 to 1700. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cayman Islands (overseas territory of the United Kingdom): Christopher Columbus discovered the islands in 1503 after winds blew him off his course from Panama to Hispaniola. He called the islands Las Tortugas ("The Turtles" in Spanish) due to the many turtles there. Around 1540, the islands gained the name Caymanas, from a Carib word for marine alligators or "caiman", an animal found on the islands. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Central African Republic: Named after its geographical position in the center of the continent of Africa; see also List of continent name etymologies. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    China: From Cin (???), Persian name for China used by Marco Polo.[4] Derived from Sanskit Cinah (???).[5] Often said to derive from Qin (221 BC - 206 BC), although usage pre-dates this dynasty.[6] Chinese: Zhong Guo — "central country" Archaic English Cathay, Turkish Xytai and Russian ????? (Kitai), from the Khitan people who conquered north China in the 10th century. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Christmas Island (territory of Australia): So named because Captain William Mynors discovered the island on Christmas Day in 1643. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Clipperton Island (territory of France): Named after the English mutineer and pirate John Clipperton, who hid there in 1705. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cocos Islands (territory of Australia): Named after coconuts, the main local product. Keeling Islands (alternative name), after Captain William Keeling, who discovered the islands in 1609. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Colombia: Named after the explorer Christopher Columbus, despite the fact that he never was in the country as we know it today. During his fourth voyage Columbus did visit Panama, which was part of Colombia until 1903. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Comoros: From the Arabic Djazair al Qamar: "island of the moon." (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cook Islands (territory of New Zealand): Named after Captain James Cook, who sighted the islands in 1770. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Croatia: Latinization of the Croatian name Hrvatska, derived from Hrvat (Croat): a word of unknown origin, possibly from a Sarmatian word for "herdsman" or "cowboy".[citation needed] Might be related to an aboriginal tribe of Alans. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cuba: From Taíno Indian Cubanacan — "centre place". In Portugal, some believe that the name echoes that of the Portuguese town of Cuba, speculating that Christopher Columbus provided a link. In Portuguese and Spanish, the word "cuba" refers to the barrels used to hold beverages. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Cymru Cymru is the Welsh name for Wales, thought to mean "Land of the Compatriots" in Old Welsh. The term "Welsh" comes from the Anglo-Saxon "Wealh", meaning foreigner or unfamiliar neighbour. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Czechoslovakia: Roughly "land of the Czechs and Slovaks", from the two main Slavic ethnic groups in the country, with "Slovak" deriving from the Slavic for "Slavs"; and "Czech" ultimately of unknown origin. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Czech Republic: From Cechové (Ceši, i.e. Czechs), the name of one of the Slavic tribes on the country's territory, which subdued the neighboring Slavic tribes around 900. The origin of the name of the tribe itself remains unknown. According to a legend, it comes from their leader Cech, who brought them to Bohemia. Most scholarly theories regard Cech as a sort of obscure derivative, i.e. from Ceta (military unit). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Denmark: From the native name Danmark, meaning "march (i.e., borderland) of the Danes", the dominant people of the region since ancient times. The origin of the tribal name is unknown, but one theory derives it from the Proto-Indo-European root dhen: "low" or "flat", presumably referring to the low elevation of most of the country. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Djibouti: Named after the bottom point of the Gulf of Tadjoura. Possibly derived from the Afar word gabouti, a type of doormat made of palm fibres. Another plausible, but unproven, etymology is that "Djibouti" means "Land of Tehuti" or Land of Thoth, after the Egyptian Moon God. French Territory of the Afars and the Issas (former name): after the colonial ruler (France) and the two main ethnic groups in the country. See also France, below. French Somaliland (former name): after the colonial ruler (France). For Somaliland see Somalia below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Dominica: From Medieval Latin "Dies Dominica" meaning "Sunday": the day of the week on which Christopher Columbus first landed on the island. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Dominican Republic: Derived from Santo Domingo, the capital city, which bears the name of the Spanish Saint Domingo de Guzmán, the founder of the Dominican Order. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Ecuador: "Equator" in Spanish, as the country lies on the Equator. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Egypt: From Latin Aegyptus, which in turn is from ancient Greek (already attested in Mycenean) ????pt?? (Aígyptos). According to Strabo, the Greek name is derived from ???a??? ?pt??? (Aigaíou hyptíos) or "the land below the Aegean sea"). Alternatively, it may derive from the Egyptian name of Memphis, *hawit ku? pitáh, meaning "house (or temple) of the soul of Ptah". Misr (Arabic name, pronounced Masr in Egyptian Arabic): a widespread Semitic word (Hebrew: Mitzraim), first used to mean "Egypt" in Akkadian, and meaning "city" or "to settle or found" in Arabic. The Turkish name Misir derives from the Arabic one. The Hebrew name is in the dual form, meaning "two Egypts" and may evoke the old kingdoms of upper and lower Egypt. The Hebrew form can also mean "straits or narrow places", referring to the shape of the country as it follows the Nile River, and takes on more symbolic weight in the Bible in reference to the Exodus story. Kême (Coptic name): "black land" (Ancient Egyptian kmt), referring to the mud of the Nile after the summer flood, as opposed to the desert, called "red land" (Ancient Egyptian dšrt). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    England (Country of the United Kingdom): Derived from the Old English name Englaland, literally translatable as "land of the Angles". The indigenous languages of Ireland and Scotland refer to England as the "land of the Saxons" — for example, Irish Sasana. Cornish — also a Celtic language — uses Pow Saws — literally "Saxon country". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Equatorial Guinea: "Equatorial", from the word "equator". The Equator does not pass through the country's land, though the country straddles the Equator, as its island of Annobon lies to the south, while the mainland lies to the north. "Guinea" perhaps comes from the Berber term aguinaoui, which means "black". Spanish Guinea (former name): after the former colonial ruler (Spain). "Guinea" as above; See also Spain, below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Eritrea: Named by Italian colonizers, from the Latin name for the Red Sea, Mare Erythraeum ("Erythraean Sea"), which in turn derived from the ancient Greek name for the Red Sea: ?????? T??assa (Eruthra Thalassa). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Estonia: From the Latin version of the Germanic word Estland, which could originate from the Germanic word for "eastern (way)", or from the name Aestia, first mentioned in ancient Greek texts. Palaeogeographers have not located Aestia exactly: the name may have instead referred to modern Masuria in Poland. Chud (Old East Slavic): originally derived from the Gothic for "people" (see "Deutschland" under the heading "Germany"); more recent folk-etymology has also linked the name to the Slavic root for "weird". Lake Peipus still bears the name of "Chudskoe Lake" in Slavic languages. Igaunija (Latvian): from the ancient Ugaunian tribe in southeastern Estonia. Viro (Finnish variant): from the ancient Vironian tribe in northern Estonia. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Ethiopia: From the Greek word ?????p?a (Aithiopía, Latin Æthiopia), from ?????? (Aithíops), "Ethiopian" — sometimes parsed by Westerners as a purely Greek term meaning "of burnt (a??-) visage (??)". However, some (i.e., the 16–17th c. Book of Aksum [Matshafa Aksum]) Ethiopian sources state that the name derived from "'Ityopp'is", a son of Cush, son of Ham who, according to legend, founded the city of Aksum. Abyssinia (former alternate name): derives from an Arabic form of the Ge'ez (and other Ethiosemitic languages) word Habesha, a name referring to the collection of all tribes in ancient Ethiopia. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Falkland Islands (overseas territory of the United Kingdom): The English Captain John Strong named the strait between the two main islands the Falkland Sound when he landed on the islands in 1690, and the term eventually came to apply to the whole island group. The name honoured Anthony Cary, 5th Viscount Falkland, First Lord of the Admiralty, whose family name was also their residence "Falkland Palace" in Scotland. Islas Malvinas (Spanish language name): comes from the French sailors who frequented the islands during the 1690s. They came from St. Malo in Brittany, France, so others often referred to them in French as the "Malouines". Sebald Islands — a nearly defunct name of Dutch origin which commemorated Sebald de Weert, who is usually credited with first sighting the Falkland Islands in 1598. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Fiji: From the Tongan name for the islands: Viti. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Finland: From Germanic, meaning "Land of the Finns". Originally, the Germanic term Finn, deriving possibly from finthan ("wander, find"), and carried forth in the North Germanic languages, probably referred to hunter-gatherers, whose closest cultural successors in modern terms would be the Sami people. Latin Fennia. Suomi (Finnish name), Soome (Estonian name), Sum' (Old Russian name), Somija (Latvian name): may derive from the Baltic root zeme for "land": zeme ? sheme ? shäme ? Häme ? shaame ? Saami ? Soomi ? Suomi. An Fhionnlainn (Irish name) is derived from Finlandia though by coincidence Fionnlann also means "Land of the fair" in Irish. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Formosa (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    France: Main article: Name of France French derivation of Francia, "Land of the Franks". A frankon was a spear used by the early Franks, thus giving them their name. The term "Frank" later became associated with "free" as the Franks were the only truly freemen, since they subjugated the Romanized Gauls. Gallia (Latin) from the name of a Celtic tribe. Many Celtic groups used similar names: compare Gaul, Galatia, and Galicia. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    French Guiana (territory of France): See France above and Guyana below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    French Polynesia (territory of France): The geographic term "Polynesia" means "many islands", formed from the Greek roots p??? (polý), "much, many" and ??s?? (nesos), "island". See also France above. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Gabon: From Gabão, the Portuguese name for the Komo river estuary (French: Estuaire de Gabon). The estuary took its name from its shape, which resembles that of a hooded overcoat (gabão). Gabão comes from Arabic ???? (qaba’). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Gambia, The: From the river Gambia that runs through the country. The word gambia supposedly derives from the Portuguese word câmbio (meaning "trade" or "exchange"), in reference to the trade the Portuguese carried out in the area. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Georgia (the west Asian country): Main article: Name of Georgia Derived from Persian Gurj,[7][8] probably derived from a PIE term meaning "mountainous". In classical times Greeks referring to the region used the names of Colchis (the coastal region along the Black Sea) and Iberia (further inland to the east). Some also believed that Georgia was so named by the Greeks on account of its agricultural resources, since "georgia" (?e????a) means "farming" in Greek. However, the apparently Greek name is now taken to be a derivation from the Persian root Gurj.[9] Both names probably derive from indigenous Caucasian languages. Gruzia in Slavic languages (?????? in Russian, for example) and in Hebrew (??????), and Gorjestân (???????) in Persian derive from the same source. Gruzia, probably imported from Russian, is used in Vietnamese. Sakartvelo (Georgian name; in English commonly "Kartvelia"): derived from a pagan god called Kartlos, once regarded as the father of all Georgians. Vrastan (Armenian: ???????) (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Germany: Main article: Names for Germany From Latin "Germania", of the 3rd century BC, of unknown origin. The Oxford English Dictionary records theories about the Celtic roots gair ("neighbour") (from Zeuss), and gairm ("battle-cry") (from Wachter and from Grimm). Eric Partridge suggested *gar ("to shout"), and describes the gar ("spear") theory as "obsolete". Italian, Romanian, and other languages use the latinate Germania as the name for Germany. The Irish language uses An Ghearmáin, also cognate. Allemagne (French), Alemania (Spanish), Alemanha (Portuguese), ??????? (Arabic), Almân (Persian), Almanya (Turkish): from the name of the Alamanni, a southern Germanic tribe, itself probably meaning "all the men", i.e. referring to a confederation of tribes. Deutschland (German), Duitsland (Dutch): from the Old High German word diutisc, meaning "of the people" (itself from ancient Germanic thiuda or theoda, "people") and land, "land": "land of the people". Of the same root are Tyskland (Danish, Norwegian, Swedish), Þýskaland (Icelandic) and tedesco (Italian adjective form). Niemcy (Polish), Nemecko (Czech), Nemecko (Slovak), Nemcija (Slovene), ???????? ("nemetski") — but ???????? ("Germania") for the country (Russian), Németország (Hungarian): Either from a Slavic root meaning "mute", "dumb", i.e., metaphorically, "those who do not speak our language" or from the Germanic Nemetes tribe. Purutia (Tahitian): Prussia. Saksa (Estonian, Finnish): from the name of the Germanic tribe of Saxons (in turn, possibly from Old High German sahs, "knife"). Vacija (Latvian), Vokietija (Lithuanian). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Ghana: After the ancient West African kingdom of the same name. The modern territory of Ghana, however, never formed part of the previous polity. J. B. Danquah suggested the use of the name in the run-up to Ghanaian independence. His research led him to believe that modern Ghanaian peoples descended from the ancient Ghana Kingdom; others dispute his conclusions. Gold Coast (former name): after the large amount of gold that colonisers found in the country. Compare the names Europeans gave to nearby stretches of shore: "Ivory Coast", "Slave Coast" and "Grain Coast". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Gibraltar (overseas territory of the United Kingdom): A corruption of the Arabic words Jebel Tarik which means "Tarik's Mountain", named after Tarik-ibn-Zeyad, a Berber who landed at Gibraltar in 711 to launch the Islamic invasion of the Iberian Peninsula. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Greece: Main article: Names of the Greeks From the Latin Græcus (Greek G?a????, claimed by Aristotle to refer to the name of the original people of Epirus)[10] Hellas/Ellas/Ellada (Greek name): land of the Hellenes, descended in mythology from the patriarch Hellen (not the abducted Helen); From Ancient Greek ????? (Hellen) "Greek" of unknown etymology. In Greek mythology ?????, whom the ?????e? (Hellenes) "Greeks" were named after, was the son of ?e??a???? (Deucalion) and ????a (Pyrrha). Hurumistan (Kurdish variant), Ur?m (????, Adyghe): Saberdzne?i (??????????, Georgian): Yunanistan (Azeri, Kurdish variant, Turkish), al-Yunan (Arabic), Yunan (Persian), Yavan (Hebrew): after Ionians, an older name for Greeks of Asia Minor (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Grenada: After the southern Spanish city of Granada. From Jewish and Arabic inhabitants around 1000 AD: Gárnata (Arabic: ??????). Columbus originally named the island Concepción ("Conception" in English). Guadeloupe territory of France): Christopher Columbus named the island in honour of Santa María de Guadalupe in Extremadura, Spain, when he landed in 1493. The Spanish spelling is Guadalupe. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Guam (territory of the United States of America): From the native Chamorro word guahan, meaning "we have". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Guatemala: The country name comes from the Nahuatl Cuauhtemallan, "place of many trees", a translation of K'iche' Mayan K’ii’chee’, "many trees" (that is, "forest").[11] When the Spanish arrived, they saw a decayed tree with lots of trees around it right in front of the palace. The Spanish believed this the center of the Mayan Kingdom. When the Spanish asked the name of the area, the Native Amerindians told them that name. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Guinea: From the Susu (Sousou) language meaning "Women". The first Europeans to arrive in the area would have heard Susu, the main language spoken by the inhabitants of coastal Guinea. The English form comes via Portuguese Guiné from a (presumed) indigenous African name. Or possibly from the Berber Akal n-Iguinawen meaning "land of the blacks". French Guinea (former name): after the colonial ruler (France), and "Guinea" as above. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Guyana: From the indigenous peoples who called the land "Guiana", meaning "land of many waters", in reference to large number of rivers in the area. British Guiana (former name): after the colonial ruler (Britain). "Guiana" has the same etymology as "Guyana". See also Britain above (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Haiti: From Taíno/Arawak Indian, Hayiti or Hayti, meaning "mountainous land", originally Hayiti. The name derives from the mountainous and hilly landscape of the western half of the island of Hispaniola. Hispaniola (name of the island shared by Haiti and the Dominican Republic) — Spanish for "Little Spain". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Honduras: Christopher Columbus named the country "Honduras", Spanish for "depths", referring to the deep waters off the northern coast. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Hong Kong: The name "Hong Kong" in the English language is an approximate phonetic rendering of the Cantonese or Hakka pronunciation of the spoken Cantonese name "??", meaning "fragrant harbour".[12] Before 1842, the name Hong Kong originally referred colloquially to a small inlet (now Aberdeen Harbour/Little Hong Kong) between the island of Ap Lei Chau and the south side of the island which later became known as Hong Kong. The inlet was one of the first points of contact between British sailors and local fishermen.[13] The reference to fragrance may refer to the harbour waters sweetened by the fresh water esturine influx of the Pearl River, or to the incense factories lining the coast to the north of Kowloon which was stored around Aberdeen Harbour for export, before the development of Victoria Harbour.[12] In 1842, the Treaty of Nanking was signed, and the name Hong Kong was first recorded on official documents to encompass the entirety of the Island.[14] The Convention of Peking (1860) and Convention for the Extension of Hong Kong Territory (1898) added the Kowloon peninsula and New Territories into Hong Kong's territory, which has remained unchanged until the present. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Hungary: Turkic: on-ogur, "(people of the) ten arrows" — in other words, "alliance of the ten tribes". Byzantine chronicles gave this name to the Hungarians; the chroniclers mistakenly assumed that the Hungarians had Turkic origins, based on their Turkic-nomadic customs and appearance, despite the Finno-Ugric language of the people. The Hungarian tribes later actually formed an alliance of the seven Hungarian and three Khazarian tribes, but the name is from before then, and first applied to the original seven Hungarian tribes. The ethnonym Hunni (referring to the Huns) has influenced the Latin (and English) spelling. Uhorshchyna (????????, Ukrainian), Vuhoršcyna (??????????, Belarusian), Wegry (Polish), Wedzierskô (Kashubian), and Ugre (Old Russian): from the Turkic "on-ogur", see above. The same root emerges in the ethnonym Yugra in Siberia, inhabited by Khanty and Mansi people, the closest relatives to Hungarians in the Finno-Ugric language family. Magyarország (native name — "land of the Magyars"), and derivatives, eg. Czech Madarsko, Turkish Macaristan: According to a famous Hungarian chronicle (Simon of Kéza: Gesta Hunnorum et Hungarorum, 1282), Magyar (Magor), the forefather of all Hungarians, had a brother named Hunor (the ancestor of the Huns); their father king Menrot, builder of the tower of Babel, equates to the Nimrod of the Hebrew Bible. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Iceland: Main article: Names for Iceland "Land of ice" (Ísland in Icelandic). Popularly (but falsely) attributed to an attempt to dissuade outsiders from attempting to settle on the land. In fact, the early explorer and settler Flóki Vilgerðarson named the island after spotting "a firth full of drift ice" to the north[citation needed]. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    India: Main article: Origin of India's name Derived from Sindhu, the original name of the Indus River which gave its name to the land of Sindh. Derivations of the Persian form of the name, Hind, were later applied to the region encompassing modern-day Pakistan, India, and Bangladesh, prior to their separation in 1947. Bharat (Sanskrit name): Popular accounts derive "Bharat" from the name of either of two ancient kings named Bharata. Hindustan (Hindi name): The name Hind is from a Persian pronunciation of Sind. The Persian -stan means "country" or "land" (cognate to Sanskrit sthana: "place, land"). India is known as al-Hind (?????) in Arabic (and sometimes Persian, as in in the 11th century text; Tarik Al-Hind, "history of India") and Hind (???) in Persian. It also occurs intermittently in India, as in the phrase "Jai Hind". The terms Hind and Hindustan were current in Persian and Arabic from the 11th century Islamic conquests: the rulers in the Sultanate and Mughal periods called their Indian dominion, centred around Delhi, Hindustan. The word Hindu (??????) was lent from Persian into Sanskrit in early medieval times and is attested — in the sense of dwellers of the Indian subcontinent — in some texts, such as Bhavishya Purana, Kalika Purana, Merutantra, Ramakosha, Hemantakavikosha and Adbhutarupakosha. The name Hindustan was in use synonymously with India during the British Raj. The term is from the Persian Hindustan ????????,[clarification needed] as is the term Hindu itself. It entered the English language in the 17th century. In the 19th century, the term as used in English referred to the northern region of India between the Indus and Brahmaputra and between the Himalayas and the Vindhyas in particular, hence the term Hindustani for the Hindi-Urdu language. rGya.gar (Dzongkha), rGya.gar.yal (Tibetan variant): ??????? or ???? H?ddû (Hebrew): (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Indonesia: apparently invented in the mid-19th century to mean "Indies Islands", from the Greek ??s?? (nesos, "island"), added to the country name "India". (Europeans previously referred to Indonesia as the "East Indies".) Dutch East Indies (Dutch: Nederlands Oost-Indie) (former name): after the former colonial ruler (Netherlands). Nam Duong (Vietnamese variant): (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Iran: "Land of the Aryans" or "land of the free". The term "Arya" is from a Proto Indo-European root, generally meaning "noble" or "free", cognate with the Greek-derived word "aristocrat". Persia (former name): from Latin, via Greek Persis, from Old Persian Paarsa, a place name of a central district within the region: modern Fars. A common Hellenic folk-etymology derives "Persia" from "Land of Perseus". Uajemi (Swahili variant): from the Arabic word Ajam, which means any non-Arabs, including Persians, specifically, "the ones whose language we don't understand"[citation needed]. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Iraq: One theory is that it is derived from the city of Erech/Uruk (also known as "Warka") near the river Euphrates. Some archaeologists regard Uruk as the first major Sumerian city. However, it is more plausible that name is derived from the Middle Persian word Erak, meaning "lowlands". The natives of the southwestern part of today's Iran called their land "the Persian Iraq" for many centuries (for Arabs: Iraq ajemi: non-Arabic-speaking Iraq). Before the constitution of the state of Iraq, the term "Iraq arabi" referred to the region around Baghdad and Basra. Mesopotamia (ancient name and Greek variant): a loan-translation (Greek meso- (between) and potamos (river), meaning "Between the Rivers") of the ancient Semitic Beth-Nahrin, "Land of two Rivers", referring to the Tigris and Euphrates rivers. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Ireland: After "Éire" from Proto-Celtic *Iweriu, "the fertile place" or "Place of Éire (Eriu)", a Celtic fertility goddess. Often mistakenly derived as "Land of Iron", or from a reflex of Proto-Indo-European *arya, or from variations of the Irish word for "west" (modern Irish iar, iarthar). Hibernia (ancient name and Latin variant): apparently assimilated to Latin hibernus ("wintry"). Ireland is known as Eirinn in Scottish Gaelic, from a grammatical case of Éire. In the fellow Celtic languages: in Welsh it is Iwerddon; in Cornish it is Ywerdhon or Worthen; and in Breton it is Iwerzhon. In Gaelic bardic tradition Ireland is also known by the poetical names of Banbha (meaning "piglet") and Fódhla. In Gaelic myth, Ériu, Banbha and Fódla were three goddesses who greeted the Milesians upon their arrival in Ireland, and who granted them custody of the island. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Israel: Israel takes its name from the biblical patriarch Jacob, later known as Israel, literally meaning "struggled with God/he struggles with God". According to the account in the Book of Genesis, Jacob wrestled with a stranger at a river ford and won—through perseverance. God then changed his name to Israel, signifying that he had deliberated with God and won, as he had wrestled and won with men. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Jamaica: Taíno/Arawak Indian Xaymaca or Hamaica, "Land of wood and water" or perhaps "Land of springs". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Japan: See also: Names of Japan From Geppun, Marco Polo's Italian rendition of the islands' Chinese name ?? (pinyin: rìben, at the time approximately jitpun), or "sun-origin", i.e. "Land of the Rising Sun", indicating Japan as lying to the east of China (where the sun rises). Also formerly known as the "Empire of the Sun". Nihon / Nippon: Japanese name, from the local pronunciation of the same characters as above. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Jordan: After the river Jordan, the name of which derives from the Hebrew and Canaanite root yrd — "descend" (into the Dead Sea.) The river Jordan forms part of the border between Jordan and Israel/West Bank. Transjordan (former name): "Trans" means "across" or "beyond", i.e. east of the river Jordan. Urdun (Arabic), literal translation of name Jordan, sometimes spelled Urdan. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Kazakhstan: Means "land of the Kazakhs". Kazakh means something like "independent-rebellious-wanderer-brave-free". The Russian term kazak (?????) is a cognate—"cossack" in English. The Persian suffix -stan means "land". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Kenya: After Mount Kenya, from the Kikuyu name Kere-Nyaga ("Mountain of Whiteness"). British East Africa (former name): after its geographical position on the continent of Africa and the former colonial power, (Britain). See also Britain, above, and Africa on the Place name etymology page. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Kiribati: An adaptation of "Gilbert", from the former European name the "Gilbert Islands". Pronounced ['ki?ibas]. Gilbert Islands (former name): named after the British Captain Thomas Gilbert, who sighted the islands in 1788. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Korea (South and North): From "Gaoli," a name used by Marco Polo. It is derived from "Goryeo Dynasty" (918–1392). This name is a shortened form of Goguryeo (37 BC to AD 668). South Koreans call Korea Hanguk (from the Great Han Empire of 1897–1910), while North Koreans call it Joseon (from the Kingdom of Great Joseon (1392-1897)). See also: Names of Korea. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Kosovo: Kosovo is a widely used place name in Slavic countries, stemming from the word kos, which means "blackbird". Meaning land of the blackbirds in Serbian. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Laos: Coined under French rule, derived from Lao lao, meaning "a Laotian" or "Laotian", possibly originally from an ancient Indian word lava. (Lava is the name of one of the twin sons of the god Rama.) The name might also be from Ai-Lao, the old Chinese name for the Tai ethnic groups to which the Lao people belong.[16] Formerly known as Lan Xang or "land of a million elephants". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Latvia: Derived from the regional name Latgale, the "Lat-" part associated with several Baltic hydronyms, and -gale meaning "land" or "boundary land", of Baltic origin. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Lebanon: The name Lebanon (Lubnan in standard Arabic; Lebnan or Lebnèn in local dialect) is derived from the Semitic root "LBN", which is linked to several closely-related meanings in various languages, such as "white" and "milk". This is regarded as a reference to the snow-capped Mount Lebanon. Occurrences of the name have been found in three of the twelve tablets of the Epic of Gilgamesh (2900 BC), the texts of the library of Ebla (2400 BC), and the Bible (71 times in the Bible's Old Testament). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Lesotho: After the indigenous Sotho people, whose own name means "black" or "dark-skinned". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Liberia: From the Latin liber: "free", so named because the country was established as a homeland for freed (liberated) African-American slaves. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Libya: After an ancient Berber tribe called Libyans by the Greeks and Rbw by the Egyptians. Until the country's independence, the term "Libya" generally applied only to the vast desert between the Tripolitanian Lowland and the Fazzan plateau (to the west) and Egypt's Nile river valley (to the east). With "Tripoli" the name of new country's capital, and the old northeastern regional name "Cyrenaica" having passed into obsolescence, "Libya" became a convenient name for the country, despite the fact that much of the desert called the Libyan desert is Egyptian territory. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Liechtenstein: From the German "Light stone" ("light" as in "bright"). The country took its name from the Liechtenstein dynasty, which purchased and united the counties of Schellenburg and Vaduz. The Holy Roman Emperor allowed the dynasty to re-name the new property after itself. Liechtenstein and Luxembourg are the only German-speaking former Holy Roman Empire duchies not assimilated by the countries Germany, Austria, and Switzerland. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Luxembourg: From Celtic Lucilem "small" (cognate to English "little") and Germanic burg: "castle", thus lucilemburg: "little castle". Luxembourg and Liechtenstein are the only German-speaking former Holy Roman Empire duchies not assimilated by the countries Germany, Austria, and Switzerland. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Macau: The territory's name is a Portuguese adaptation of a local name for the bay: A-Ma-Gao or Bay of A-Ma. Adapted by the Portuguese as Macau or Macao.[17] (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Macedonia: The country name is from the Greek: ?a?ed???a (Makedonía),[18][19] a kingdom (later, region) named after the ancient Macedonians. Their name, ?a?ed??e? (Makedónes), derives ultimately from the ancient Greek adjective µa?ed??? (makednós), meaning "tall, taper",[20] which shares the same root as the noun µ????? (mákros), meaning "length" in both ancient and modern Greek.[21][22][23] The name is originally believed to have meant either "highlanders" or "the tall ones".[24] The provisional term the former Yugoslav Republic of Macedonia is used in many international contexts in acknowledgment of a political dispute with Greece over the historical legitimacy of the country's use of the name. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Madagascar: From the name of the island in Malagasy language: Madagasikara, itself derived from the proto-Malay "end of the Earth",[citation needed] a reference to the island's long distance by sea from an earlier homeland in Southeast Asia. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Malawi: Possibly based on a native word meaning "flaming water" or "tongues of fire," believed to have derived from the sun's dazzling reflections on Lake Malawi. But President Hastings Banda, the founding President of Malawi, reported in interviews that in the 1940s he saw a "Lac Maravi" shown in "Bororo" country on an antique French map titled "La Basse Guinee Con[t]enant Les Royaumes de Loango, de Congo, d'Angola et de Benguela" and he liked the name "Malawi" better than "Nyasa" (or "Maravi"). "Lac Marawi" does not necessarily correspond to today's Lake Malawi. Banda had such influence at the time of independence in 1964 that he named the former Nyasaland "Malawi", and the name stuck. Nyasaland (former name): "Nyasa" literally means "lake" in the local indigenous languages. The name applied to Lake Malawi (formerly Lake Nyasa, or "Niassa"). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Malaysia: The word Malaya is a combination of two Tamil/Sanskrit words, Malay or Malai (hill) and Ur (town), meaning hilltown. The name came into use when several Indian Kingdoms entered Malaysia dating back to the 3rd Century (see Srivijaya). Hence, the Latin/Greek suffix -sia, makes the name Malaysia, literally meaning Land of the Malay people. The continental part of the country bore the name Malaya (without the "-si-") until 1963, when it federated with the territories of Sabah, Sarawak and Singapore on the northern part of the island of Borneo. Singapore was expelled in 1965. The name change indicated the change of the country's boundaries beyond Malay Peninsula. Malaysian refers to Malaysians of all races, while Malay refers to the native Malay people, who are about half the population. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Maldives: From the Arabic mahal ("palace") or Dhibat-al-Mahal / Dhibat Mahal, as Arabs formerly called the country. Therefore it could mean "Palace Islands", because the main island, Malé, held the palace of the islands' Sultan. Some scholars believe that the name "Maldives" derives from the Sanskrit maladvipa, meaning "garland of islands". Some sources say that the Tamil malai or Malayalam mala: "mountain(s)", and Sanskrit diva: "island", thus, "Mountain Islands". Dhivehi Raajje (Maldivian name): "Kingdom of Maldivians". Dhivehi is a noun describing the Dhives people (Maldivians) and their language "Dhivehi" simultaneously. Maladwipa: Sanskrit for "garland (mala, pronounced /maalaa/) of islands"; or, more likely, "small islands", from mala (pronounced /mala/) meaning "small". Dhibat Mahal (Arabic). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mali: After the ancient West African kingdom of the same name, where a large part of the modern country is. The word mali means "hippopotamus" in Malinké and Bamana. French Sudan (former colonial name). In French Soudan français. The term Sudan (see below) stems from the Arabic bilad as-sudan: "land of the Blacks". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Malta: From either Greek or Phoenician. Of the two cultures, available evidence suggests that the Greeks had an earlier presence on the island, from as far back as 700 BC.[25] The Greeks are known to have called the island Melita meaning "honey", as did the Romans; solid evidence for this is Malta's domination by the Byzantine Empire from 395 through to 870. It is still nicknamed the "land of honey".[25][26] The theory for a Phoenican origin of the word is via Maleth meaning "a haven".[27] The modern-day name comes from the Maltese language, through an evolution of one of the earlier names. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Marshall Islands: Named after British Captain John Marshall, who first documented the existence of the islands in 1788. Marshallese: M¸ajel (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Martinique (territory of France): When Christopher Columbus landed on the island in 1502 he named it in honour of St. Martin. (He had sailed past it in 1493 but did not land.) (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mauritania: Latin for "land of the Moors". Misnamed after the classical Mauretania in northern Morocco, itself named after the Berber Mauri or Moor tribe. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mauritius: Named Prins Maurits van Nassaueiland in 1598 after Maurice of Nassau (1567–1625), Stadtholder of Holland and Prince of Orange (1585–1625). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mexico Main article: Etymology of Mexico After the Mexica branch of the Aztecs. The origin of the term "Mexxica" is uncertain. Some take it as the old Nahuatl word for the sun. Others say it derived from the name of the leader Mexitli. Others ascribe it to a type of weed that grows in Lake Texcoco. Leon Portilla suggests that it means "navel of the moon" from Nahuatl metztli ("moon") and xictli ("navel"). Alternatively, it could mean "navel of the maguey" (Nahuatl metl). See also Mexican state name etymologies. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Moldova Main article: Etymology of Moldova From the Moldova River in Romania, possibly from Gothic Mulda: "dust", "mud", via the Principality of Moldavia (Moldova in Romanian). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Monaco From the ancient Greek monoikos 'single-dwelling', through Latin Monoecus. Originally the name of an ancient colony founded in the 6th century B.C. by Phocian Greeks, and a by-name of the demigod Hercules worshiped there. (The association of Monaco with monks (Italian monaci) dates from the Grimaldi conquest of 1297: see coat of arms of Monaco.) (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mongolia From Mongol; it probably means "brave" or "fearless". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Montenegro Venetian conquerors gave Montenegro its name, Montenegro meaning "black mountain", after the appearance of Mount Lovcen or most likely its dark coniferous forests. "Montenegro" is in the Venetian dialect), while the standard Italian would be monte nero, without the "g". Crna Gora (the local Serbian/Montenegrin name for Montenegro): literally translates as "black mountain". Doclea (ancient name for Montenegro): Doclea, the name of the region during the early period of the Roman Empire, reflected the name of an early Illyrian tribe. In later centuries, Romans "hyper-corrected" it to "Dioclea", wrongly guessing that an "I" had disappeared due to vulgar speech corruption. Zeta (ancient name for Montenegro): The earliest Slavic name Zeta derives from the name of a river in Montenegro which itself derives from an early root meaning "harvest" or "grain". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Montserrat (territory of the United Kingdom): Christopher Columbus named the island "Santa Maria de Montserrate" while sailing past it in 1493 because it reminded him of the Blessed Virgin of the Monastery of Montserrate in Spain. "Montserrat" itself literally means "jagged mountain". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Morocco: From Marruecos, the Spanish pronunciation of the name of the city of "Marrakesh" (more precisely Marrakush), believed to derive from the Berber words (ta)murt: "land" (or (a)mur "part") + akush: "God". Al Maghrib (Arabic name): "the farthest west". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Mozambique: From the name of the Island of Mozambique, which in turn probably comes from the name of a previous Arab ruler, the sheik Mussa Ben Mbiki. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Myanmar: One explanation is that the name derives from the Burmese short-form name Myanma Naingngandaw. An alternative etymology suggests that myan means "quick/fast" and mar means "hard-tough-strong". The re-naming of the country in 1989 has aroused political controversy: certain minority groups and activist communities perceive "Myanmar" to be a purely Burmese name that reflects the policy of domination of the ethnic Burman majority over the minorities. Those groups do not recognize the legitimacy of the ruling military government nor its authority to change the English name of the country. Accordingly, such groups, who have become accustomed to calling the country by its English name, continue to refer to Myanmar as "Burma". Burma (former name): The name Burma apparently derives from the Sanskrit name for the region: Brahmadesh, land of (the deity) Brahma. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Nauru: The name "Nauru" may derive from the Nauruan word Anáoero, which means "I go to the beach". The German settlers called the island Nawodo or Onawero. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Nepal: The name "Nepal" is derived from "Nepa" as mentioned in the historical maps of South Asia. "Nepa" literally means "those who domesticate cattle" in the Tibeto-Burman languages. The land was known by its people the Nepa or Nepar, Newar, Newa, Newal etc., who still inhabit the area i.e. the valley of Kathmandu and its surroundings. The Newa people use "Ra" and "La" or "Wa" and "Pa" interchangeably, hence the different names mentioned above. Some say it derives from the Sanskrit nipalaya, which means "at the foot of the mountains" or "abode at the foot," referring to its proximity to the Himalayas. (Compare the analogous European toponym "Piedmont".) Others suggest that it derives from the Tibetan niyampal, which means "holy land". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Netherlands: Germanic for "low lands". Holland (part of the Netherlands; a name often incorrectly used to refer to the country as a whole): Germanic holt-land ("wooded land") (often incorrectly regarded as meaning "hollow [i.e. marsh] land"). Batavia (Latin): derived from the name of the Germanic Batavii tribe. Nederland (Dutch) "low-land". (Neder is a Dutch cognate to the English "nether": low or lower.) Alankomaat (Finnish): "low lands". Na hÍsiltíre (Irish): "the low lands". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Netherlands Antilles: (territory of Netherlands): "Antilles" from a mythical land or island (Antillia), west of Europe, or a combination of two Portuguese words ante or anti (possibly meaning "opposite" in the sense of "on the opposite side of the world") and ilha ("island"), currently the name for these Caribbean Islands. "Netherlands" after the colonial ruler, the Netherlands. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    New Caledonia (territory of France): Captain James Cook named the islands in 1774 after Scotland, which is "Caledonia" in Latin). The mountains he saw reminded him, he said, of those in Scotland. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    New Zealand: After the province of Zeeland in the Netherlands, which means "sea land", referring to the large number of islands it contains. Abel Tasman referred to New Zealand as Staten Landt, but later Dutch cartographers used Nova Zeelandia, in Latin, followed by Nieuw Zeeland in Dutch, which Captain James Cook later anglicised to New Zealand. Aotearoa has become the most common name for the country in the indigenous Maori language, supplanting the loan-phrase Niu Tireni. Aotearoa conventionally means "land of the long white cloud". Nua Shealtainn in both Irish and Scottish Gaelic, meaning "New Shetland" (Sealtainn), itself from a metathesised form of Scots Shetland. Gaelic speakers seem to have folk-etymologised Zeeland when translating New Zealand's name from English. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Nicaragua: A merger coined by the Spanish explorer Gil González Dávila after Nicarao, a leader of an indigenous community inhabiting the shores of Lake Nicaragua and agua, the Spanish word for "water"; subsequently, the ethnonym of that native community. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Niger: English pronunciation: nee-zhay. Named after the Niger River, from a native term Ni Gir or "River Gir". The name has often been misinterpreted, especially by Latinists, to be derived from the Latin niger ("black"), a reference to the dark complexions of the inhabitants of the region. See also Nigeria, below. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Nigeria: After the Niger river that flows through the western areas of the country and into the ocean. See also Niger, above. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Niue (territory of New Zealand): Niu probably means "coconut," and é means "behold." According to legend, the Polynesian explorers who first settled the island knew that they had come close to land when they saw a coconut floating in the water. There is also a coincidental similarity with the Germanic words niew, nieu, niewe, niue, nieue, niewe, nieuw, nieuwe, niuewe niuew, new, and the Latinic neo. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Norfolk Island (territory of Australia): The first European known to have sighted the island, Captain James Cook, in 1774, on his second voyage to the South Pacific on HMS Resolution, named it after the wife of the premier peer of Britain, Edward Howard, 9th Duke of Norfolk (1685–1777). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Northern Mariana Islands (commonwealth in political union with the United States of America): Portuguese explorer Ferdinand Magellan (the first European to sight the islands, in 1521), named them Islas de los Ladrones ("Islands of Thieves"). In 1668 Jesuit missionary San Vitores changed the name to Las Marianas in honour of Mariana of Austria (1634–1696), widow of king Philip IV and regent of Spain (1665–1675). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    North Korea: After the location in Korea. See also Korea above (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Norway: From the old Norse norðr and vegr, "northern way". Norðrvegr refers to long coastal passages from the western tip of Norway to its northernmost lands in the Arctic. Natively called Norge (Noreg in Nynorsk). Urmane, or Murmane in Old Russian: from the Norse pronunciation of the word Normans: "Northmen". (This word survives in the name of the Russian city Murmansk.) An Iorua (Irish) seems to derive from a misinterpretation of Old Norse Norðrvegr as beginning the Irish definite article an, common to most country names in Irish. The rest of the word was then taken as the country name. (A similar process took place in the development of the English word "adder": originally "a nadder".) (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Occitania: Occitània in Occitan. From medieval Latin Occitania (approximately since 1290). The first part of the name, Occ-, is from Occitan [lenga d']òc or Italian [lingua d']oc (i.e. "Language of Òc"), a name given to the Occitan language by Dante according to its way of saying "yes" (òc). The ending -itania is probably an imitation of the old Latin name [Aqu]itania]. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Oman: The name Oman (also Uman) is ancient. In his translation of a History of the Imams and Seyyids of Oman, George Badger says that the name was already in use by early Greek and Arab geographers. The book Oman in History (Arabic: Tarikh fi Uman) notes that the Roman historian Yalainous (23–79 AD) mentions a city on the Arab peninsula he calls "Omana." The city (probably ancient Sohar, on the Omani coast) gave its name to the region. According to Tarikh fi Uman, "various Arab scholars proposed a variety of different linguistic origins for the name 'Oman'." Ibn al-Qabi suggested it comes from the adjective aamen, or amoun, meaning "settled (as opposed to nomadic) man." Other scholars have suggested the city was named after any of a number of historic, legendary or biblical founding figures, including Oman bin Ibrahim al-Khalil, Oman bin Siba' bin Yaghthan bin Ibrahim, Oman bin Qahtan, and Oman bin Loot (the Arabic name for the biblical figure Lot). Still others have suggested the name is based on a valley in Yemen from which the city's founders came. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Pakistan: The Cambridge student and Muslim nationalist Choudhary Rahmat Ali coined this name. He devised the word and first published it on 28 January 1933 in the pamphlet "Now or Never". He constructed the name as an acronym of the different states/homelands/regions, which broke down into: P=Punjab, A=Afghania (Ali's preferred name for the North West Frontier Province), K=Kashmir, S=Sindh and the suffix -stan from Balochistan, thus forming "Pakstan". An "i" intruded later to ease pronunciation. The suffix -stan in Persian means "home of" and in Sanskrit means "place". Rahmat Ali later expanded upon this in his 1947 book Pakistan: the Fatherland of the Pak Nation. In that book he explains the acronym as follows: P=Punjab, A=Afghania, K=Kashmir, I=Indus Valley, S=Sindh, T=Turkharistan (roughly the modern central-Asian states), A=Afghanistan and N=BalochistaN. The Persian word ??? pak, which means "pure", adds another shade of meaning, with the full name thus meaning "land of the pure". Many Central and South Asian states and regions end with the element -Stan, such as Afghanistan, Pakistan, Baluchistan, Kurdistan and East Turkestan. This Stan is formed from the Iranian root *STA "to stand, stay," and means "place (where one stays), home, country." Iranian peoples have been the principal inhabitants of the geographical region occupied by these states for over thousand years. The names are compounds of -Stan and the name of the people living there. Pakistan is a bit of exception; its name was coined in 1933 using the suffix -istan from Baluchistan preceded by the initial letters. Interestingly, a word almost identical in form, etymology, and meaning to the Iranian suffix -stan is found in Polish, which has a word stan meaning "State" (in the senses of both polity and condition). It can be found in the Polish name for the "United States of America." Stany Zjednoczone Ameryki (literally "States United of America". Use of the name gradually spread during the successful campaign for the seccesion of a Muslim state from British India Empire. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Panama: After a former village near the modern capital, Panama City. From the Cueva Indian language meaning "place of abundance of fish" or "place of many fish", possibly from the Caribe "abundance of butterflies", or possibly from another native term referring to the Panama tree. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Peru: The exact meaning behind the word "Peru" is obscure. The most popular theory derives it from the native word biru, meaning "river" (compare with the River Biru in modern Ecuador). Another explanation claims that it comes from the name of the Indian chieftain Beru. Spanish explorers asked him the name of the land, but not understanding their language, he assumed they wanted his own name, which he gave them. Another possible origin is pelu, presumptively an old native name of the region. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Philippines: "Lands of King Philip" (Philip II of Spain, reigned 1556–1598). The suffix "-ines" functions adjectivally. A recent and romantic descriptive name, "Pearl of the Orient Seas", derives from the poem, Mi Ultimo Adios, written by Philippine nationalist hero José Rizal. Other names include Katagalugan (used by the Katipunan when referring to the Philippines and meaning "land/region of the river-dwellers", though that name originally refers to the Tagalog areas) and Maharlika (from the name of the upper class in pre-Hispanic Philippines, meaning "noble"). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Poland: "Land of Polans", the territory of the tribe of Polans (Polanie). When the Polans formed a united Poland in the 10th century, this name also came into use for the whole Polish country. The name "Poland" (Polska) expressed both meanings until, in the 13th/14th century, the original territory of the Polans became known as Greater Poland (Wielkopolska) instead. The name of the tribe comes probably from Polish pole: "field" or "open field". Lengyelország (Hungarian), Lenkija (Lithuanian), Lahestân (Persian) all derive from the Old Ruthenian or Old Polish ethnonym ledenin (possibly "man ploughing virgin soil") and its augmentative lech. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Saint Kitts and Nevis: St. Kitts took its name in honour of Saint Christopher, the patron saint of travelling. Christopher Columbus probably named the island for Saint Christopher, though this remains uncertain. British sailors later shortened the name to St. Kitts. Nevis derives from the Spanish phrase Nuestra Senora de las Nieves, which means "Our Lady of the Snows", after the permanent halo of white clouds that surrounded mountains on the island. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Saint Lucia: According to tradition, named after Saint Lucy by French sailors shipwrecked on the island on 13 December 1502 – the feast day of Saint Lucy. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Samoa: The islands allegedly derive their name from that of a local chieftain, or from an indigenous word meaning "place of the moa". The moa, a large bird now extinct, may have served as the islanders' totem. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Scotland ( Country of the United Kingdom): Main article: Etymology of Scotland Land of the Scots, from Old English Scottas, "inhabitants of Ireland." Old English borrowed the word from late Latin Scotti, of unknown origin. It may possibly have come from an Irish term of scorn, scuit. After the departure of the Romans from Britain in 423, an Irish tribe invaded Scotland, and the name came with them. It later extended to other Irish who settled in the northern regions of Britain. Alba (Gaelic name): The Scots- and Irish-Gaelic name for Scotland derives from the same Celtic root as the name Albion, which designates sometimes the entire island of Great Britain and sometimes the country of England, Scotland's southern neighbour. The term arguably derives from an early Indo-European word meaning 'white', generally held to refer to the cliffs of white chalk around the English town of Dover, ironically located at the furthest end of Great Britain from Scotland itself. Others take it to come from the same root as "the Alps", possibly being an ancient word for mountain. Originally referred to all of Britain, but later referred to the Gaelic colonies in Britain, and eventually only to Scotland- the last Gaelic colony. Caledonia, an old Latin name for Scotland, deriving from the Caledonii tribe. Caledonia in Greek also means "good waters". (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Serbia The exact origin of the name is uncertain (see name of Serbs). The name of the Sorbs in present-day Germany has the same origin. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Slovakia: From the Slavic "Slavs". The origin of the word Slav itself remains controversial. See also: origin of the term Slav (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    South Georgia and the South Sandwich Islands (territory of the United Kingdom): On 17 January 1775 the British Captain James Cook landed on the main island and named it the "Isle of Georgia" in honour of King George III of the United Kingdom. He named the South Sandwich Islands after John Montagu, the 4th Earl of Sandwich, who served as the First Lord of the Admiralty at the time and who had helped fund Cook's explorations. The word "South" was added to distinguish these islands from the Sandwich Islands, now known as Hawaii. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    South Korea: After the location in Korea. See also Korea above (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Switzerland: From the toponym Schwyz (see there) first attested AD 972 as Suittes, derived from an Alemannic proper name Suito. Helvetia (ancient Latin name), after the Celtic Helvetii people. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Tajikistan: Main article: Tajik people "Tajikistan" or "Tojikiston" (alternative name) means "land of the Tajiks", with "Tajiks" being an alternative name of the Persians. Tajikistan is the only country in the Soviet Union Commonwealth which is Persian-speaking and its history goes back to the Persian Empire. The suffix -stan, from Persian, means "land". The root word toj is derived from the Persian word for "crown". Because of the influence of the Russians during the Soviet period, the root word toj changed slightly and in time became tojik. The literal meaning of "Tajikistan" is "place where people have crowns." Another possible root is the Tibetan Tag Dzig (pronounced "Tajik") by which they call all Persians, but in Tibetan this also means "tiger-leopard".[citation needed] This could explain why so many Tibetan legends about their western neighbours feature tiger/leopard combinations. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    United Arab Emirates: The etymology of the term "Arab" or "Arabian" links with that of the place name "Arabia". The root of the word has many meanings in Semitic languages, including "west / sunset", "desert", "mingle", "merchant", "raven" and "comprehensible", all of which appear to have some relevance to the emergence of the name. Emirate refers to a territory ruled by an emir. Trucial States, Trucial Oman (former names): Before 1971 English-speakers knew the area as the "Trucial States" or "Trucial Oman", in reference of a nineteenth-century truce between the British and Arab sheikhs. It borders Oman and Saudi Arabia. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    United Kingdom: Shortened form of the full name: "The United Kingdom of Great Britain and Northern Ireland". The original 'United Kingdom' came into being on May 1st, 1707 when the Treaty of Union took effect and united the Kingdom of England (that included Wales) and the Kingdom of Scotland to create a state referred to as the United Kingdom of Great Britain[34] In 1801, union with the Kingdom of Ireland created the United Kingdom of Great Britain and Ireland which officially changed to its present style in 1927 following the separation from the Union of the then Irish Free State (now Ireland), 5 years earlier. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Wales (Country of the United Kingdom): From Old English Waelisc, Walh, meaning "Romanised" (Old English Waelisc also provides the source of English word Welsh). Anglo-Saxons used their version of an Old Teutonic term to apply to speakers of Celtic languages as well as to speakers of Latin. The same etymology applies to walnuts (meaning: nut of the Roman lands) as well as to Cornwall in Britain and to Wallonia in Belgium. Old Church Slavonic also borrowed the term from the Germanic, and it served as the origin of the name of the Romanian region of Wallachia.[36] Gaul or Gallia, as well as Gael and Gaelic share the same etymology, as G and W are often interchangeable between English and French (wasp/guêpe, ward/garde, etc.). In fact, the French word for Wales is "Pays de Galles", and Welsh is translated as "Gallois". The Welsh word for Wales is Cymru, for the Welsh language Cymraeg, and for the Welsh people Cymry. (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Western Sahara (claimed by Morocco and the Sahrawi Arab Democratic Republic): After its geographic position in the west of the Sahara desert. "Sahara" is an English pronunciation of the word for desert in Arabic. The local nationalist group the Polisario Front have named their government in exile the "Sahrawi Arab Democratic Republic" after its people, the Sahrawis (or Saharawis). Spanish Sahara (former name): after its geographic position in the Sahara desert and the former colonial power (Spain). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Yugoslavia (former name): From Jugoslavija, which means "Land of the South Slavs" (South Slavic jug means "south"). (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
  • ()

  • List of etymologies of country subdivision names

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_etymologies_of_country_subdivision_names


  • ()

  • List of continent name etymologies

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_continent_name_etymologies


  • ()

  • List of political entities named after people

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_political_entities_named_after_people


  • ()

  • Lists of etymologies

    (E?)(L?) http://en.wikipedia.org/wiki/Lists_of_etymologies


  • ()

  • List of double placenames

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_double_placenames


  • ()

  • Toponymy

    (E?)(L?) http://en.wikipedia.org/wiki/Toponymy


    Erstellt: 2010-??

    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    References
    • ^ http://www.etymonline.com/index.php?search=albania&searchmode=none
    • ^ Anguilla's History, Government of Anguilla website
    • ^ a b Encounter 1802 – 2002 : Collection Item View
    • ^ "China", Online Etymology Dictionary
    • ^ "china", The American Heritage Dictionary of the English Language, Boston and New York, Houghton-Mifflin, 2000.
    • ^ Liu, Lydia He, The clash of empires, p. 77.
    • ^ Curtis, Glenn E. (2004). Georgia a Country Study. Kessinger Publishing. pp. 89. ISBN 1419121650.
    • ^ Nasmyth, Peter (2001). Georgia: In the Mountains of Poetry. Routledge. pp. 9. ISBN 0700713956.
    • ^ Wilson, Nigel Guy (2006). Encyclopedia of Ancient Greece. Routledge. pp. 320. ISBN 0415973341.
    • ^ http://www.etymonline.com/index.php?search=greek&searchmode=none
    • ^ Campbell, Lyle (1997). American Indian Languages: The Historical Linguistics of Native America. Oxford: Oxford University Press, pg. 378 n. 10
    • ^ a b Room, Adrian (2005). Placenames of the World. McFarland. pp. p168. ISBN 0786422483. http://books.google.co.uk/books?id=M1JIPAN-eJ4C&pg=PA168&lpg=PA168&dq=hong+kong+etymology+fragrant+harbor&source=web&ots=idqkH_NOZK&sig=tDrezBcwrNKBib14Z6XRa-z9VhI&hl=en&sa=X&oi=book_result&resnum=10&ct=result.
    • ^ Bishop, Kevin; Roberts, Annabel (1997). China's Imperial Way. China Books. pp. p218. ISBN 9622175112. http://books.google.co.uk/books?id=1c0UyPNF_I0C&pg=PT216&lpg=PT216&dq=%22Heung+Gong+Tsai%22&source=web&ots=hwfbi_cIdH&sig=O12V-P04XM9fFJl7xWxFKLMW5Kw&hl=en&sa=X&oi=book_result&resnum=3&ct=result#PPT214,M1.
    • ^ Fairbank, John King. Trade and Diplomacy on the China Coast: The Opening of the Treaty Ports, 1842-1854. 2 vols. Cambridge, MA: Harvard University Press, 1953.
    • ^ Word Origins Vol. 841.
    • ^ Singto – Dedicated to Thai Boxing, and all things Thai
    • ^ Your Complete Guide to Macau at the Internet Archive
    • ^ Macedonia, Henry George Liddell, Robert Scott, "A Greek-English Lexicon", at Perseus
    • ^ http://www.etymonline.com/index.php?search=Macedonia&searchmode=none
    • ^ Makednos, Henry George Liddell, Robert Scott, "A Greek-English Lexicon", at Perseus
    • ^ Makros, Henry George Liddell, Robert Scott, "A Greek-English Lexicon", at Perseus
    • ^ http://translate.google.com/translate_t#auto|en|%CE%BC%CE%AC%CE%BA%CF%81%CE%BF%CF%82
    • ^ http://el.wiktionary.org/wiki/%CE%BC%CE%B1%CE%BA%CF%81%CF%8C%CF%82
    • ^ Macedonia, Online Etymology Dictionary
    • ^ a b "Notable dates in Malta's history". Department of Information – Maltese Government. 6 February 2008. http://www.doi.gov.mt/EN/islands/dates.asp.
    • ^ "Controversy over unique Maltese bee population". Malta Today. 6 February 2008. http://www.maltatoday.com.mt/2003/06/29/l7.html.
    • ^ Pickles, Tim. Malta 1565: Last Battle of the Crusades. Osprey Publishing. ISBN 978-1855326033. http://books.google.com/books?id=0LuvbRQ78sIC&pg=PA11&lpg=PA11&dq=Maleth+Malta+haven&source=web&ots=PGO2OF9Y9I&sig=rcodiMbexlDy5YwMXhelH7zEYyw.
    • ^ UNESCO in action cultureThe shipwrecked memory of the L'Utile slaves: UNESCO
    • ^ Room, Adrian (2006). Placenames of the World: Origins and Meanings of the Names for 6,600 Countries, Cities, Territories, Natural Features, and Historic Sites. McFarland. pp. 385. ISBN 0786422483.
    • ^ Taylor, Isaac (2008). Names and Their Histories: A Handbook of Historical Geography and Topographical Nomenclature. BiblioBazaar, LLC. pp. 281. ISBN 0559296681.
    • ^ Houtsma, Martijn Theodoor (1987). E.J. Brill's First Encyclopaedia of Islam, 1913-1936. Brill. pp. 838. ISBN 9004082654.
    • ^ Rossi, Peter M.; White, Wayne Edward (1980). Articles on the Middle East, 1947-1971: A Cumulation of the Bibliographies from the Middle East Journal. Pierian Press, University of Michigan. pp. 132.
    • ^ Welcome parliament.uk, accessed 15 August, 2009
    • ^ Nhu Trong Trung Bon Thi, "[www.anviettoancau.net/html/capnhat_7/trbontai.pdf An Introduction to Vietology]", p. 3.
    • ^ [[Davies, John |Davies, John]] (1994). A History of Wales. London: Penguin. pp. 71. ISBN 0-14-01-4581-8.
    • Room, Adrian. Brewer's Names: People. Places. Things. Cassell, 1992. ISBN 0-304-34077-4
    • Room, Adrian. Placenames of the World, Origins and Meanings. McFarland and Company, Inc, Publishers, 1997. ISBN 0-7864-0172-9
    • [hide]v • d • eLists by country
    Articles that include one or more maps are shown in italics.
    • Lists of topics Country articles · portals · categories · topics
    • Culture · Demography · Economy · Geography · History · Law enforcement · Maps · Politics · Religion · Sport · Tourism · Transport
    • Codes Airline codes · Call sign (ITU) prefixes · Country calling codes · FIFA country codes · FIPS country codes · Internet TLDs · IOC country codes · ISO country codes · Ship prefixes
    • Names and symbols Demonyms · Etymologies · Native names · Anthems · Coats of arms · Flags · National emblems · National mottos
    • Politics and government Administrative divisions · Current heads of state and government · Election results · Intelligence agencies · Legislatures (by size) · Militaries · Office-holders · Political parties (party systems) · Sovereign states · Systems of government · UN member states · Voting systems
    • Places Cathedrals · Cemeteries · Cities · Islands · National capitals (Former national capitals) · National parks · Schools · Universities and colleges · World Heritage Sites
    • Other data by country Abortion law · Association football (soccer) · Battles · Capital punishment · Cardinals · Common surnames · Cuisines · Currencies · Education · Emergency contraception · Energy · Euthanasia and the law · Forex rates · Human rights · LGBT rights · Music genres · Newspapers · Novelists · Official languages · People · Railway companies · School leaving age · Tram and light-rail transit systems
    • Other lists Member states of the European Union (by accession · by political system) · Oldest person · Tallest buildings and structures


    (E?)(L?) http://en.wikipedia.org/wiki/List_of_country_name_etymologies
    Languages:
    • Deutsch
    • Español
    • Italiano
    • Polski
    • Português


  • Nepper
  • Nepper (W3)

    Dt. "Nepper"

    (E?)(L?) http://www.nepperschlepper.de/


    Erstellt: 2010-02

  • Faktum
  • Faktum (W3)

    Auf dem lat. "facere" = dt. "machen", "tun" beruht nicht nur das "Faktum", lat. "factum" = wörtlich dt. "das Gemachte" (und plur. die "Fakten"), sondern vile weitere gängige Begriffe, wie:
    • "Faksimile" ("machs ähnlich")
    • "Faktion" ("das Machen")
    • "Faktor" (lat. "factor" = "Macher", "Verfertiger")
    • "Faktorei" (lat. "factoria" = "Geschäft")
    • "Faktotum" (lat. "fac totum" = "mache alles!")
    • "Faktur" (ital. "fattura", lat. "factura" = "Bearbeitung")
    • "fakturieren"
    • "Fakultät" (lat. "facultas", Gen. "facultatis" = "Wissensgebiet", "Forschungsgebiet")


    Der "Fakir" allerdings geht zurück auf arab. "faqr" = dt. "arm", "Armer".

    Erstellt: 2010-02

  • Diktaphon
  • Diktaphon (W3)

    Das "Diktaphon", dt. "Diktiergerät", setzt sich zusammen aus lat. "dictare" = "diktieren" (lat. "dicere" = dt. "sprechen") und griech. "phone" = dt. "Stimme".

    Erstellt: 2010-02

  • Dukaten
  • Dukaten (W3)

    Interessant finde ich, wie der vom 13. bis 19. Jh. in ganz Europa verbreitete "Dukaten" auf lat. "ducere" = "führen" basiert. Die Verbindung verläuft über mhd. "ducat", ital. "ducato", lat. "ducatus" = "Herzogtum", lat. "dux" = "Führer", lat. "ducere" = "ziehen", "führen".

    Erstellt: 2010-02

  • Crossword Puzzle
  • Crossword Puzzle (W3)

    Das engl. "Crossword Puzzle" soll von Arthur Wynne eingeführt worden sein. Sein erstes "Kreuzworträtsel" erschien am 21.12.1913 in der Sonntagszeitung "New York World".

    In "The Times" erschien das erste "Kreuzworträtsel" am 01.02.1930.

    Erstellt: 2010-02

  • Gordischer Knoten
  • Gordischer Knoten (W3)

    Den sprichwörtlichen "Gordischen Knoten" soll Alexander der Große in der eroberten Stadt Gordion in Kleinasien durchtrennt haben.

    Erstellt: 2010-02

  • Burns Night
  • Burns Night (W3)

    Das schottische Fest "Burns Night" wird zu Ehren des Dichters "Robert Burns" gefeiert, der am 25. Januar 1759 geboren wurde. Er erstellte den Text zu dem englischen Silvesterlied schott. "Auld Lang Syne" = dt. "die gute alte Zeit", wörtlich dt. "alt lang seit".

    Erstellt: 2010-02

  • Simpsons
  • Simpsons (W3)

    Die "Simpsons" sind eine Erfindung des Comiczeichners Matt Groening (1954-)

    Erstellt: 2010-02

  • God often gives nuts to toothless people
  • God often gives nuts to toothless people (W3)

    Den Ausspruch engl. "God often gives nuts to toothless people" = dt. "Gott schenkt oft zahnlosen Nüsse" findet man bei Matt Groening (1954-) dem Erfinder des "Simpsons".

    Erstellt: 2010-02

  • to call somebody's bluff
  • to call somebody's bluff (W3)

    Engl. "to call somebody's bluff" = dt. "jemanden auf die Probe stellen", geht zurück auf die wörtliche Bedeutung eines Ausdrucks aus dem Pokerspiel engl. "calling a bluff" = "die anderen Spieler auffordern ihre Karten auf den Tisch zu legen", also den vermuteten Bluff (die Täuschung) aufzudecken.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-02


    Erstellt: 2010-02

  • to raze something to the ground
  • to raze something to the ground (W3)

    Engl. "to raze something to the ground" (16. Jh., 1620) = dt. "etwas dem Erdboden gleichmachen", geht zurück auf das Verb engl. "raze" = "auslöschen", "löschen", "tilgen", woraus auch der Substantiv engl. "razor" = "Rasiermesser", "Rasierapparat" zurück geht.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-03


    Erstellt: 2010-02

  • to hit the roof
  • to hit the roof (W3)

    Engl. "to hit the roof" (Anfang 20. Jh.) = dt. "vor Wut an die Decke gehen", ist die metaphorische Beschreibung von jemandem, der in Wut gerät. Während die Deutschen allerdings von der Decke gestoppt werden, scheinen die Engländer durch die Decke bis ans Dach zu gehen.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-04


    Erstellt: 2010-02

  • to paint the town red
  • to paint the town red (W3)

    Engl. "to paint the town red" = dt. "auf die Pauke hauen", geht (vermutlich) zurück auf einen Aufstand, der durch den "Marquis of Waterford" und einiger Freunde in Melton Mowbray, einer kleinen Stadt in Leicestershire, England, verursacht wurde, als sie verschiedene Häuser rot anmalten.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-05


    Erstellt: 2010-02

  • Les arts de la table (site-du-jour)
  • site-du-jour
    Les arts de la table

    (E?)(L?) http://www.site-du-jour.com/dossiers/arts-table.html


  • abaque
  • abaque (W3)



    (E?)(L1) http://www.site-du-jour.com/dossiers/calculatrice.html
    La calculatrice et son histoire

    L'abaque fut la première machine à calculer. Les peuples antiques en faisaient usage plusieurs siècles avant Jésus-Christ dans leurs diverses opérations marchandes. On note quatre types d'abaque ayant principalement eu cours dans l'Antiquité : un tableau de sable sur lequel on traçait/effaçait les opérations et que les Grecs nommaient "abax" ; une tablette avec des compteurs mobiles sur des lignes, des galets par exemple sur l'abaque égyptienne ; le fameux boulier chinois qui consiste en une boîte rectangulaire, traversée de plusieurs tiges sur lesquelles se trouvent des boules présentant des valeurs différentes ; et enfin une tablette avec des galets coulissant dans des rainures, chez les Romains.
    ...


  • calculatrice
  • calculatrice (W3)



    (E?)(L?) http://gerard.evrard.free.fr/Pages/Histoire.html
    • Histoire - le déroulement
    • Time Line des principales machines
    • Evolution des caractéristiques
    • Evolution des familles par constructeur
    • Glossaire
    Quelques machines importantes et technologies jalonnent la route, que je vous propose de suivre vue de ma fenêtre : subjectivement donc.

    Qu'est ce qu'une calculatrice ?

    Avant de commencer notre voyage, voyons de quoi nous parlons : une calculatrice est un moyen de calcul portable, personnel, autonome. Mes favorites sont Scientifiques et Programmables, mais cela ne définit qu'un sous-ensemble des calculatrices.

    Pour les divers termes mis en rouge, voir le glossaire en fin de page.
    ...


    (E?)(L?) http://histoiredechiffres.free.fr/compter/sommaire.htm
    L'entaille | Les doigts | Quipus | Abaque | Bouliers | Machines | la pascaline

    Bien des étapes ont dûes être franchies avant d'arriver à la première calculatrice ! Vous trouverez ici les premières machines à compter : les os et l'entaille, les calculs avec les doigts, les quipus, les tables à compter et les bouliers compteurs puis une historique des machines mécaniques.
    Les hommes ont toujours essayé de faire des calculs de plus en plus vite.
    Le premier instrument pour faire des opérations : les doigts,
    les abaques : d'abord sous forme de lignes tracées dans le sable sur lesquelles on place des cailloux pour représenter des nombres
    le boulier inventé en Chine entre 2.000 et 3.000 avant JC
    puis viennent les calculs écrits.
    Au XVIIe siècle , Pascal invente une machine mécanique capable d'effectuer des additions , soustractions à l'aide de mouvements de roues dentées . La première de ces machines comporte six chiffres , les suivantes en auront huit.
    Avec l'utilisation de l'électricité puis de l'électronique , les calculatrices deviennent de plus en plus petites et de plus en plus performantes.


    (E?)(L1) http://people.math.jussieu.fr/~gouny/enseignt_fichiers/Histoire_calcul.pdf
    Du doigt à la machine, le calcul LE PETIT JOURNAL

    L’histoire de la machine à calculer est complexe. D’abord, parce que plusieurs de ces étapes sont constituées d'emprunts mutuels, un inventeur prenant à un autre un élément ou un principe qu'il modifie. Ensuite, parce que plusieurs de ces machines visent à des buts différents et réalisent des opérations différentes.
    ...


    (E?)(L?) http://www.la-calculatrice.com/
    DE LA CALCULATRICE HYPOTHECAIRE A LA CALCULATRICE DE L'AMOUR ... TOUS LES OUTILS UTILES POUR LES CALCULS ET LES CONVERSIONS ...

    Calculatrice en ligne | Calculatrice hypothécaire | Calculatrice pourcentage | Calcul surface | Calcul volume | Calcul livret A | Calculatrice financière | Tableau de conversion | Conversion celsius | Conversion metrique | Conversion poids | Conversion litre | Calcul décalage horaire | Calcul crédit payé | Convertisseur monétaire | Conversion euro | Calcul impot revenu | Calculer la TVA (taxes) | Calcul TPS / TVQ (taxes) | Calcul TVA 5.5 | Convertir salaire brut / net | Calculatrice de l'amour | Calcul itineraire routier | Calculer ascendant | Calcul poids santé (IMC) | Calculer ovulation | Calculer date accouchement | Calcul des calories


    (E?)(L?) http://www.les-calculatrices.com/histoire-calculatrice.html
    LES CALCULATRICES
    • > Calculatrice en ligne
    • > Calculatrice mathématique
    • > Calculatrice en temps réel
    • > Calculatrice financière
    • > Calculatrice ludique
    • > Convertisseur d'unitée
    • > Convertisseur numérique
    • > Acheter une calculatrice
    • > Autres calculatrices
    NOS DOSSIERS
    • > Histoire de la calculatrice
    • > Histoire des mathématiques
    • > Les grands mathématiciens
    • > Histoire des chiffres
    • > Les nombres extraordinaires
    • > Les chiffres dans le monde
    • > Les unités de mesure
    • > Fonctionnement du crédit
    • > Les dangers du crédit
    • > Crédit immobilier


    (E?)(L1) http://www.site-du-jour.com/dossiers/calculatrice.html
    La calculatrice et son histoire

    L'abaque fut la première machine à calculer. Les peuples antiques en faisaient usage plusieurs siècles avant Jésus-Christ dans leurs diverses opérations marchandes. On note quatre types d'abaque ayant principalement eu cours dans l'Antiquité : un tableau de sable sur lequel on traçait/effaçait les opérations et que les Grecs nommaient abax ; une tablette avec des compteurs mobiles sur des lignes, des galets par exemple sur l'abaque égyptienne ; le fameux boulier chinois qui consiste en une boîte rectangulaire, traversée de plusieurs tiges sur lesquelles se trouvent des boules présentant des valeurs différentes ; et enfin une tablette avec des galets coulissant dans des rainures, chez les Romains.
    ...


  • Serment d'Hippocrate
  • Serment d'Hippocrate (W3)

    Der frz. "Serment d'Hippocrate" (dt. "der Eid des Hippokrates") geht zurück auf den griechischen Arzt Hippocrates (-460 - -370) und ist Vorbild des Ärztegelöbnisses.

    (E?)(L?) http://www.site-du-jour.com/dossiers/hippocrate.html
    Sans la lucidité et l'audace de l'illustre Hippocrate (460 av. J.-C.- vers 370av. J.-C.), la médecine de l'Antiquité aurait longtemps été l'otage de superstitions liées aux dieux et déesses des cultes helléniques. Fils et petit-fils de médecin, Hippocrate naît autour de 460 av. J.-C. sur l'île de Kos, territoire grec. Il aurait reçu, en plus de l'éducation de son père, une formation en médecine des prêtres-médecins appartenant à la confrérie d'Asclépios, les Asclépiades.
    ...
    Alors qu'il a débarrassé la médecine de son carcan de superstitions, Hippocrate s'attaque ensuite à l'instauration d'une éthique médicale. De cette volonté naît le fameux "Serment d'Hippocrate", encore solennellement prêté aujourd'hui (sous différentes formes) par tous les nouveaux diplômés, ainsi que plus d'une soixantaine d'ouvrages traitant de différents volets de la médecine de l'époque.
    ...


  • Champagne
  • Champagne (W3)



    (E?)(L1) http://www.champagne.fr/
    • LE COMITE CHAMPAGNE: Le comité Champagne | Maisons de Champagne | Vignerons de Champagne | Appellation Champagne | Bureaux du Champagne | Economie | Paysages du Champagne | Contact
    • TOUT SUR LE CHAMPAGNE: Situation particulière de la Champagne | Localisation du vignoble | Histoire | Appellation Champagne | Terroir | Vigne | Elaboration | Développement durable | Diversité des vins de Champagne | Service et dégustation | Accords gastronomiques | Economie | Confréries
    • OENOTOURISME CHAMPAGNE: Carte du vignoble de Champagne | Routes du Champagne | Maisons de Champagne | Vignerons de Champagne | Coopératives de Champagne | Hôtels | Restaurants | Visites culturelles | Fêtes et manifestations | Confréries | Paysages du Champagne
    • ESPACE PRESSE: Communiqués de presse | Dossiers de presse | Photothèque Champagne


    Champagne.fr vous certifiez être majeur et avoir connaissance de la règlementation en vigueur dans votre pays relative à l'information sur les boissons alcoolisées diffusée sur internet.


    (E?)(L1) http://www.champagne-de-france.com/
    Champagne de France - Un guide pour bien choisir vos champagnes de producteur ou de maison de champagne et mener à bien votre achat ou la vente de champagne brut, rosé, demi-sec ou grand cru en ligne. Ainsi qu'une partie dédiée à l'histoire, la géographie et l'économie du vin de champagne.

    L'Histoire | La Géographie | Les Cépages | La Vinification | Les Champagnes | La Bouteille | Le Service | Le Marché | Les Maisons


    (E?)(L1) http://www.chateauloisel.com/champagne/
    (E?)(L1) http://www.chateauloisel.com/champagne/champagne-degustation.htm
    Déguster le Champagne
    ...
    Autres articles du dossier CHAMPAGNE:
    • Les Terroirs de Champagne
    • L'étiquette du champagne
    • Le dosage du champagne
    • Le carafage du champagne
    • Livres sur le champagne
    • Appréciations et commentaires champagne
    • Le champagne à table
    • 36 champagnes de prestige
    • Cartes Postales anciennes de Champagne
    Lire aussi :
    • Comparatif de verres à champagne


    (E?)(L1) http://www.chateauloisel.com/xtra/imagerie.htm
    (E?)(L1) http://www.maisons-champagne.com/
    (E?)(L1) http://www.maisons-champagne.com/
    (E?)(L1) http://www.maisons-champagne.com/encyclopedie/vignes_au_plaisir/sommaire.php
    0. Régions, Terroirs & Villages | 1. Travaux des vignes | 2. Vendanges | 3. Pressurage | 4. Une cuve pour chaque terroir | 5. L'assemblage de chaque Marque | 6. Tirage en bouteille | 7. Prise de mousse | 8. Lent éveil des arômes... | 9. Pointage, remuage, dépointage | 10. Dégorgement | 11. Dosage | 12. Bouchage et museletage | 13. Poignetage et mirage | 14. Habillage | 15. Etiquetage | 16. Choisir sa marque | 17. Choisir ses verres | 10 Critères | 18. Rafraîchir sa bouteille | 19. Ouvrir sa bouteille | 20. Servir son Champagne | 21. Dégustation : le langage des Sens | 10 règles de l'Art d'une dégustation | 22. Eviter les erreurs | 23. Conserver ses bouteilles | 24. Agrémenter les mets | 25. Consacrer les instants privilégiés | 26. Illustrer exploits et événements | 27. À votre santé... | 28 - 32 Arts & Lettres

    (E?)(L1) http://www.site-du-jour.com/dossiers/champagne.html
    Il est né, le divin "champagne", de la région du même nom dans le nord-est de la France. Selon des sources historiques, il semble que la région champenoise doive la naissance de ses vignes à l'époque gallo-romaine alors que les Romains y plantent les premiers ceps. Vers les débuts du 12e siècle, les vignobles de Champagne sont la propriété des moines de l'abbaye de Saint-Pierre-au-Mont située à Châlons-en-Champagne. C'est l'évêque Guillaume de Champeaux (v.1070-1121) qui ordonne la rédaction de la Grande Charte champenoise, en 1114, autorisant l'abbaye à développer et exploiter cette région en culture viticole.
    ...


    (E?)(L1) http://www.tourisme-champagne-ardenne.com/champagne/histoire-champagne-et-histoire.aspx


  • Spaßvideos von Rémi Gallard (nimportequi)
  • nimportequi
    N'importe qui Spaßvideos von Rémi Gallard

    (E?)(L?) http://www.nimportequi.com/


    Erstellt: 2010-02

  • Deutsche Geschichte (lemo)
  • lemo
    Deutsche Geschichte

    (E?)(L?) http://www.dhm.de/lemo/
    Das Fraunhofer Institut für Software- und Systemtechnik, das "Deutsche Historische Museum" ("DHM") und das "Haus der Geschichte" ("HdG") in Bonn präsentieren gemeinsam im Internet deutsche Geschichte von der Gründung des Deutschen Reichs im 19. Jahrhundert bis zur Gegenwart.

    Erstellt: 2010-02

  • Kyoto-Protokoll
  • Kyoto Protocol
  • Kyoto-Protokoll
    Kyoto Protocol (W3)

    Das "Kyoto-Protokoll", "Kyoto Protocol", wurde im Dezember 1997 in Kyoto festgelegt, trat allerdings erst im Jahr 2005 in Kraft. Es hat die Reduzierung der Treibhausgase zum Inhalt.

    Erstellt: 2010-02

  • baro
  • baro (W3)

    Dt. "Baron" = "streitbarer Mann", "freier Mann", gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "baro".

    Erstellt: 2010-02

  • birsare
  • birsare (W3)

    Dt. "pirschen", altfrz. "berser" = "jagen", gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "birsare".

    Erstellt: 2010-02

  • burgus
  • burgus (W3)

    Dt. "Burg", ahd. "burg", "burug" = "befestigte Höhe", gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "burgus".

    Erstellt: 2010-02

  • harpa
  • harpa (W3)

    Dt. "Harfe" gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "harpa".

    Erstellt: 2010-02

  • maldrum
  • maldrum (W3)

    Dt. "Malter", ein Getreidemaß, das zu "mahlen" gehört und ursprünglich die in einem Arbeitsgang "gemahlene Menge Korn" bedeutete, gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "maldrum".

    Erstellt: 2010-02

  • marcha
  • marcha (W3)

    Dt. "Mark", ahd. "marcha" = dt. "Grenze", "Grenzland", gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "marcha".

    Erstellt: 2010-02

  • marescalcus
  • marescalcus (W3)

    Dt. "Marschall" = dt. "Pferdeknecht", gehört zu den Wörtern, die als germanisches Lehnwort in die lateinische Sprache aufgenommen wurden, als lat. "marescalcus".

    Der dt. "Marschall" ist ein Reimport, der mit den Franken nach Frankreich gelangte, und als frz. "maréchal" dann wieder in die deutsche Sprache aufgenommen wurde. Das ahd. "marahscalc" = "Pferdeknecht" setzt sich zusammen aus mhd. "marc", "march", ahd. "marah" = "Pferd" (vgl. "Mähre" = "Stute") und mhd. "schalc", ahd. "scalc" = "Schalk", der jedoch ursprünglich kein Spassvogel sondern ein "Knecht" war.

    Erstellt: 2010-02

  • to hear something straight from the horse's mouth
  • to hear something straight from the horse's mouth (W3)

    Amerik. "to hear something straight from the horse's mouth" = dt. "aus erster Hand erfahren", geht zurück auf den Reitsport. Besonders gute Gewinnertipps konnte nur jemand geben, der ein Pferd oder besser alle Pferde gut kannte. Trainer und Pferdebetreuer hatten das Ohr fast wörtlich am Maul des Pferdes und galten als zuverlässige Quellen für Gewinnprognosen. Besser war es jedoch, direkt das Pferd zu fragen. Die Redewendung engl. "from the horse's mouth" findet man in gedruckter Form seit dem Jahr 1913.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-17


    Erstellt: 2010-02

  • less is more
  • less is more (W3)

    Engl. "less is more" = dt. "weniger ist mehr" soll auf den Architekten und Designer Ludwig Mies Van Der Rohe zurück gehen. Er war einer der Begründer der modernen Architektur und favorisierte einen minimalistischen Stil.Gedruckt findet man "less is more" zum ersten Mal in einem Gedicht über den Maler Andrea del Sarto aus dem jahr 1855.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-18


    Erstellt: 2010-02

  • Zichorie
  • Zichorie (W3)

    Die Pflanze "Zichorie", der Wurzeln auch zur Herstellung von Kaffeersatz verwendet wird, geht über ital. "cicoria" zurück auf lat. "cichorea", "cichoreum", griech. "kichorion" = "Wegwarte", "Endivie".

    (E?)(L?) http://www.cnrtl.fr/etymologie/chicorée


    Erstellt: 2010-02

  • Endivie
  • Endivie (W3)

    Die als Salat oder Gemüse verwendete Pflanze dt. "Endivie" geht über frz. "endive" ("chicorée sauvage"), ital. "endivia", zurück auf lat. "intiba", "intubus", griech. "entýbion".

    (E?)(L?) http://www.cnrtl.fr/etymologie/endive


    Erstellt: 2010-02

  • The Simpsons
  • The Simpsons (W3)

    Die Comicfiguren "The Simpsons" sind eine Kreation des Cartoonisten Matt Groening, der 1954 in Portland, Oregon, geboren wurde.

    Erstellt: 2010-02

  • (W3)

    Die römischen Saturnalien entsprachen etwa der heutigen Fastnacht. Sie wurden nach "Saturn", dem Gott der Saat und der Feldarbit, benannt.

    Erstellt: 2010-02

  • Thatcherism
  • Thatcherism (W3)

    Am 11.02.1975 wurde Margret Thatcher zur Vorsitzenden der britischen "Conservative Party" gewählt. Im Jahr 1979 wurde sie als erste Frau zur "Premierministerin" gewählt. Ihre politische Ideologie, die auf monetaristischen Grundsätzen basierte wurde nach ihr "Thatcherism" benannt.

    Erstellt: 2010-02

  • protocol
  • Protokoll
  • protocol
    Protokoll (W2)

    Das engl. "protocol", dt. "Protokoll", hat einen interessanten Hintergrund. Es geht zurück auf lat. "protocollum", griech. "protókollon" und setzt sich zusammen aus griech. "prõtos" = "Erster", "Wichtigster" und "kólla" = dt. "Leim", der auch in der "Kollage" steckt. Ursprünglich war das griech. "protókollon" das (einer amtlichen Papyrusrolle) vorgeleimte (Blatt), das "Davorgeleimte".

    Trotz dieser protokollierbaren Herkunft und Bedeutung haben sich das engl. "protocol" und das dt. "Protokoll" unterschiedlich entwickelt. Während das engl. "protocol" lediglich das dt. "diplomatisches Protokoll (Etikette)" bezeichnet, kann das dt. "Protokoll" im Englischen viele Bedeutungen haben und muß auch entsprechend übersetzt werden, als:
    • "journal" (Schiffstagebuch)
    • "listing" (Auflisten, Protokollierung)
    • "log" (Computer-Protokoll)
    • "minutes" (bei einer Sitzung, Sitzungsprotokoll)
    • "record" (bei Gericht "to put something on record")
    • "statement" (bei Polizei)
    • "ticket" (Strafmandat)
    • "transcript" (bei Gericht)


    Erstellt: 2010-02

  • être
  • être (W3)

    • Frz. "être" geht zurück auf lat "esse" = dt. "sein".
    • Frz. "suis" geht zurück auf lat "sum" = dt. "bin".
    • Frz. "es" geht zurück auf lat "es" = dt. "bist".
    • Frz. "est" geht zurück auf lat "est" = dt. "ist".
    • Frz. "sommes" geht zurück auf lat "sumus" = dt. "sind".
    • Frz. "êtes" geht zurück auf lat "estis" = dt. "seid".
    • Frz. "sont" geht zurück auf lat "sunt" = dt. "sind".


    Erstellt: 2010-02

  • spazio
  • spazio (W3)

    Ital. "spazio" geht zurück auf lat. "spatium" = dt. "Raum".

    Erstellt: 2010-02

  • espacio
  • espacio (W3)

    Span. "espacio" geht zurück auf lat. "spatium" = dt. "Raum".

    Erstellt: 2010-02

  • espace
  • espace (W3)

    Frz. "espace" geht zurück auf lat. "spatium" = dt. "Raum".

    Erstellt: 2010-02

  • space
  • space (W3)

    Engl. "space" geht zurück auf lat. "spatium" = dt. "Raum".

    Erstellt: 2010-02

  • faccia
  • faccia (W3)

    Ital. "faccia" geht zurück auf lat. "facies" = dt. "Gesicht".

    Erstellt: 2010-02

  • faz
  • faz (W3)

    Span. "faz" geht zurück auf lat. "facies" = dt. "Gesicht".

    Erstellt: 2010-02

  • face
  • face (W3)

    Frz. "face" geht zurück auf lat. "facies" = dt. "Gesicht".

    Erstellt: 2010-02

  • face
  • face (W3)

    Engl. "face" geht zurück auf lat. "facies" = dt. "Gesicht".

    Erstellt: 2010-02

  • membro
  • membro (W3)

    Ital. "membro" geht zurück auf lat. "membrum" = dt. "Teil", "Teilnehmer".

    Erstellt: 2010-02

  • miembro
  • miembro (W3)

    Span. "miembro" geht zurück auf lat. "membrum" = dt. "Teil", "Teilnehmer".

    Erstellt: 2010-02

  • membre
  • membre (W3)

    Frz. "membre" geht zurück auf lat. "membrum" = dt. "Teil", "Teilnehmer".

    Erstellt: 2010-02

  • member
  • member (W3)

    Engl. "member" geht zurück auf lat. "membrum" = dt. "Teil", "Teilnehmer".

    Erstellt: 2010-02

  • Curb Exchange
  • Curb Exchange (W3)

    "Curb Exchange" ist eine alte Bezeichnung für "American Stock Exchange", die heutige amerikanische Börse. Die Bezeichnung geht zurück auf engl. "curb", "kerb" = "Bordstein", "Randstein", "Straßenkante". Der amerikanische Finanzmarkt entstand in New York während der Kolonialzeit am Strassenrand, an der Bordsteinkante.

    Erstellt: 2010-02

  • OTC - over-the-counter (trading)
  • OTC (W3)

    "OTC" steht für "over-the-counter (trading)" = dt. "direkter Handel (zwischen Käufer und Verkäufer)" ("außerbörslicher Handel").

    Erstellt: 2010-02

  • NASDAQ - National Association of Securities Dealers Automated Quotation System
  • NASDAQ (W3)

    "NASDAQ" steht für "National Association of Securities Dealers Automated Quotation System" = dt. "automatisisertes Kursnotierungssystem der Vereinigung der (US-)Wertpapierhändler".

    Erstellt: 2010-02

  • Viper
  • Viper (W3)

    Dt. "Viper", geht zurück auf lat. "vipera" = dt. "Schlange" und bedeutet wörtlich (vermutlich) "die lebend Gebärende".

    Erstellt: 2010-02

  • Vettel
  • Vettel (W3)

    Dt. "Vettel" geht zurück auf lat. "vetula" = dt. "Vettel", lat. "vetulus" = "ältlich", "hässlich", lat. "vetus" = "alt".

    Erstellt: 2010-02

  • stolid
  • stolid (W3)

    Engl. "stolid" = "stur", "stumpf", "gleichmütig", "unerschütterlich" geht zurück auf lat. "stolidus" = dt. "Dummkopf".

    Erstellt: 2010-02

  • nebulös
  • nebulös (W3)

    Dt. "nebulos", "nebulös" geht über frz. "nébuleux" zurück auf lat. "nebulosus" = "neblig", "dunkel" und ist verwandt mit lat. "nebulo" = "Schaumschläger".

    Erstellt: 2010-02

  • Gurgel
  • Gurgel (W3)

    Dt. "Gurgel", geht zurück auf lat. "gurgulio" = "Hals" und ist verwandt mit dem lat. "gurgo" = "Schluckspecht".

    Erstellt: 2010-02

  • blather
  • blather (W3)

    Engl. "blather" = "quatschen", "Gewäsch", "Quatsch" geht zurück auf lat. "blatero" = "Schwätzer".

    Erstellt: 2010-02

  • Laktose
  • Laktose (W3)

    Dt. "Laktose" ("Milchzucker") geht zurück lat. "lac", "lactis" = "Milch".

    Erstellt: 2010-02

  • Reliquie
  • Reliquie (W3)

    Die "Reliquie" geht zurück auf lat. "reliqui", "reliquiae" = "die Übrigen", "Zurückgelassenes", lat. "relinquere" = dt. "zurücklassen".

    Erstellt: 2010-02

  • feminalia
  • feminalia (W3)

    Lat. "feminalia" = "Dreiviertelhosen" (die beim römischen Militär schon ab dem 2. Jh. getragen wurden) geht zurück auf lat. "femur" = "Oberschenkel". Es waren also wörtlich die "Oberschenkel(hosen)".

    Erstellt: 2010-02

  • Zehn Fachbegriffe zum Mobile World Congress (cio)
  • cio
    Zehn Fachbegriffe zum Mobile World Congress

    (E?)(L?) http://www.cio.de/news/wirtschaftsnachrichten/2224318/index.html?r=75653764827111&lid=67682
    Meldung vom 15.02.2010 15:46 Uhr
    Barcelona (dpa) - Ausgewählte Fachbegriffe zum Mobile World Congress in Barcelona:
    • "Breitband": ...
    • "LTE" = "Long Term Evolution" ...
    • Smartphone": ...
    • "Apps" = "Applikationen" ...
    • "Touchscreen": ...
    • "GPS": ...
    • "Android": ...
    • "GSM": ...
    • "Roaming": ...
    • "Net-Lock": ... Wird eine solche Sperre ausgehebelt, spricht man von einem "Jail-Break" (wie "Gefängnisausbruch").


    Erstellt: 2010-02

  • to be a high-flyer
  • to be a high-flyer (W3)

    Engl. "to be a high-flyer" = dt. "ein Überflieger sein", reicht zurück bis ins 16. Jh., also in Zeiten, in denen der Mensch noch gar nicht fliegen konnte. Allerdings gab es ein Beispiel aus der griechischen Mythologie. Ikarus, schlug die Warnungen seines Vaters in den Wind und ging in die Luft. Der Wachsanteil seiner Flügel schmolz bei der Annäherung an die Sonne und aus war der Traum. Während engl. "to be a high-flyer" jedoch eher positive Züge (im Sinne "sehr erfolgreich") trägt, vermutet man bei dt. "Überflieger" eher, dass das Scheitern als blinder Passagier mit von der Partie ist.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-16


    Erstellt: 2010-02

  • Sternenhimmel (sternenhimmel-aktuell)
  • Planeten und Sterne (sternenhimmel-aktuell)
  • sternenhimmel-aktuell
    Sternenhimmel
    Planeten und Sterne

    (E?)(L?) http://www.sternenhimmel-aktuell.de/


    Erstellt: 2010-02

  • Filmposter seit 1918 (filmposter-archiv)
  • filmposter-archiv
    Filmposter seit 1918

    (E?)(L?) http://www.filmposter-archiv.de/
    Galerie Datenbank mit 13.000+ Filmplakaten Jedes Plakat lässt sich über einen entsprechenden Link unter dem Plakat auf der eigenen Homepage einbetten.

    Erstellt: 2010-02

  • to play one's cards close to one's chest
  • to play one's cards close to one's chest (W3)

    Engl. "to play one's cards close to one's chest" (Mitte 20. Jh.) = dt. "sich nicht in die Karten schauen lassen", geht zurück auf das Verhalten beim Kartenspiel. Um die Einsichtnahme in die eigenen Karten zu verhindern, hält man sie nahe am Körper.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-12


    Erstellt: 2010-02

  • Asiatische Heilkraeuter und Heilpflanzen (siamherba)
  • siamherba
    Asiatische Heilkraeuter und Heilpflanzen
    Lexikon

    (E?)(L?) http://www.siamherba.net/


    Erstellt: 2010-02

  • Feldküchenlexikon (feldkuechen24)
  • feldkuechen24
    Geschichte der Feldküche
    Gulaschkanonen
    Feldküchenlexikon
    Feldkuechen-Rezepte

    (E?)(L?) http://www.feldkuechen24.de/


    Erstellt: 2010-02

  • IGPP - Institut fuer Grenzgebiete der Psychologie und Psychohygiene
  • IGPP (W3)

    "IGPP" steht für "Institut für Grenzgebiete der Psychologie und Psychohygiene".

    (E?)(L?) http:///


    Erstellt: 2010-02

  • Silicon Valley
  • Silicon Valley (W3)



    (E?)(L?) http://www.heise.de/newsticker/meldung/Der-Mann-der-das-Silizium-ins-Silicon-Valley-brachte-William-Shockley-zum-100-930050.html
    Der Mann, der das Silizium ins Silicon Valley brachte: William Shockley zum 100.

    Heute vor 100 Jahren wurde William Shockley geboren. Zusammen mit Walter Brattain und John Bardeen erfand er den Transistor, wofür alle drei 1956 den Nobelpreis erhielten. Später entwickelte er in den Shockley Semiconductor Laboratories den Thyristor. Sein Labor gilt heute als Keimzelle des Silicon Valleys. Die Gründer von Advanced Micro Devices, Fairchild Semiconductor, Intel und National Semiconductor hatten zuvor bei Shockley gearbeitet.
    ...


    Erstellt: 2010-02

  • to be on the warpath
  • to be on the warpath (W3)

    Engl. "to be on the warpath" = dt. "auf dem Kriegspfad sein", geht zurück auf den "war path", "path to war" der Ureinwohner Amerikas, etwa "die Überbringung der Kriegserklärung". Die englische Version ist seit 1755 nachweisbar und damit eine der frühesten amerikanischen Redewendungen. Im Zivilleben tauchte der "Kriegspfad" etwa hundert Jahre später auf und wurde von Autoren wie William Burton und Mark Twain populär gemacht.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-15


    Erstellt: 2010-02

  • ceterum censeo, Carthaginem esse delendam
  • ceterum censeo, Carthaginem esse delendam (W3)

    (E?)(L?) http://www.ceterumcenseo.net/about/
    Über das Blog:
    "ceterum censeo, Carthaginem esse delendam" – die übliche Übersetzung dafür lautet "im Übrigen bin ich der Meinung, dass Karthago zerstört werden muss"; eigentlich falsch, denn im richtigen Sinnzusammenhang, nämlich am Ende so ziemlicher jeder Rede, die Cato vor dem römischen Senat hielt, bedeutet es: "unter Verschiedenes beantrage ich, dass Karthago zerstört wird". ... – mir geht es darum, mit meiner Meinung zu Webdesign- und Medien-Themen einen kleinen Beitrag zu leisten, die Dinge besser zu machen.


    Erstellt: 2010-02

  • Etymologie-Suche (hulbee)
  • Etymology-Search (hulbee)
  • hulbee
    Etymologie-Suche
    Etymology-Search

    (E?)(L?) http://www.hulbee.de/
    (E?)(L?) http://www.hulbee.de/index.php?query=Etymologie
    (E?)(L?) http://www.hulbee.de/index.php?query=Etymology


    Erstellt: 2010-02

  • nothing to write home about
  • nothing to write home about (W3)

    Engl. "nothing to write home about" = dt. "nichts Besonderes" findet man schon seit Ende des 19. Jh. Populär wurde es allerdings in einer Zeit, die eigentlich nicht als normal bezeichnet werden sollte. Die Soldaten, die im 1. Weltkrieg tagtäglich ihr Leben riskierten, konnten oder wollten ihren Angehörigen nichts darüber berichten. Wie meistens wird das große alltägliche Sterben erst im nachinein als heroische Zeit interpretiert.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-09


    Erstellt: 2010-02

  • off the record
  • off the record (W3)

    Amerik. Engl. "off the record" (um 1930) = dt. "inoffiziell" geht vermutlich zurück auf die Rechtssprache und bezieht sich auf das gerichtliche Protokoll, engl. "court record" (vgl. dt. "etwas ist nicht für das Protokoll bestimmt").

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-10


    Erstellt: 2010-02

  • iPod
  • iPod (W3)

    Der Produktname "iPod", der 2001 auf den Markt kam, wurde durch den Film "2001: Odyssee im Weltraum" beeinflusst. Der Namensgeber Vinnie Chieco verglich den "Mac" mit dem "Raumschiff", an dem immer neue Einheiten - "Pods" - angeschlossen werden können. Das "i" wurde vor den Namen gehängt, um die Verknüpfung zum "iMac" herzustellen.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index.html


    Erstellt: 2010-02

  • BlackBerry
  • BlackBerry (W3)

    Der "BlackBerry" wurde von "Research in Motion" ("RIM") hergestellt. Die Bezeichnung des im Jahr 2001 entwickelten Produkts sollte positive Gefühle wecken. Einem der Beteiligten fiel die Ähnlichkeit der kleinen Tasten des Geräts mit Samenkörnern auf. Dies griffen die Entscheider bei "RIM" auf und man suchte nun nach einer geeigneten "Beere", engl. "berry" als Namensgeber. Schließlich entschied man sich für "BlackBerry", da das Gehäuse des Geräts schwarz war.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index.html


    Erstellt: 2010-02

  • Firefox
  • Firefox (W3)

    Der Browser "Firefox" von Mozilla wurde zunächst "Firebird" genannt. Da dieser name jedoch schon von einem anderen Open-Source-Projekt belegt war, ersetzte man "bird" durch "fox". Und so wurde aus dem "Feuervogel" ein "Feuerfuchs", dem Namen für einen "rotbraunen Panda".

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index2.html


    Erstellt: 2010-02

  • Twitter
  • Twitter (W3)

    Die Bezeichnung "Twitter" für die im Jahr 2006 von Jack Dorsey entwickelte Applikation wurde von Biz Stone initiiert. Die Beschränkung auf 140 Zeichen assoziierte er mit Vogelgezwitscher. Sein erster Vorschlag war "twttr", das dann jedoch zu "twitter" (dt. "Gezwitscher") erweitert wurd. Mit dem Dienst dieses Namens gingen Biz Stone, Jack Dorsey und Evan Williams dann online.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index2.html


    Erstellt: 2010-02

  • Windows 7
  • Windows 7 (W3)

    Microsoft wollte nicht mehr viel Geld und Aufwand in die Namenssuche stecken. Und so nannte man die siebte Auflage des weltweit eingesetzten Betriebssystems einfach "Windows 7". Immerhin wird die "7" von den meisten Menschen als positiv empfunden. Immerhin nennt die Mehrheit der Menschen die "7" als Lieblingszahl zwischen 1 und 9. Und in Märchen, Religion, Mythologie und Kalender ist die "7" auch überwiegend positiv besetzt, obwohl es auch ein paar Gegenbeispiele gibt.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index2.html


    Erstellt: 2010-02

  • ThinkPad
  • ThinkPad (W3)

    Das "ThinkPad" (dt. "Denk-Block"), anfang der 1990er Jahre von IBM entwickelt, löste interne Diskussionen aus. Der Produktnummern liebende Konzern brauchte etwas Zeit, sich an einen sprechenden Namen zu gewähnen. Bis zum Erscheinen des Notebooks im Jahr 1992 hatte man sich jedoch auf den martgängigeren Begriff "ThinkPad" geeinigt.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index3.html


    Erstellt: 2010-02

  • Android
  • Android (W3)

    Der Name "Android" (dt. "Kunstmensch") war bereits als Firmenname auf dem Markt. Die "Android Inc." war bereits mit der Entwicklung von Software für mobile Geräte beschäftigt. Im Jahr 2005 übernahm Google das Unternehmen und machte den Firmennamen zum Produktnamen. Seit Oktober 2008 ist mit dem T-Mobile G1 das erste Android-Handy in den USA erhältlich.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index3.html


    Erstellt: 2010-02

  • Wikipedia
  • Wikipedia (W3)

    Die Bezeichnung für die Online-Enzyklopädie "Wikipedia" ist ein sogenanntes "Kofferwort". Es setzt sich aus hawaiisch "Wiki" = dt. "schnell" und engl. "Encyclopedia" = dt. "Enzyklopädie" zusammen.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index3.html


    Erstellt: 2010-02

  • Kofferwort
  • Kofferwort (W3)

    "Kofferwort" ist die Bezeichnung für ein Kunstwort, bei dem zwei Wörter zu einem neuen Begriff verschmolzen werden.

    Erstellt: 2010-02

  • MacOS X
  • MacOS X (W3)

    Der "MacOS X" von Apple bekam, als zehnte Version des Betriebssystems das römische Zeichen "X" für "Zehn" angehängt.

    Die Codenamen, die Apple für sein Betriebssystem seit "MacOS X" verwendet lauten "Gepard" (MacOS X 10.0), "Puma" (MacOS X 10.1), "Jaguar" (MacOS X 10.2), "Panther" (MacOS X 10.3), "Tiger" (MacOS X 10.4), "Leopard" (MacOS X 10.5), "Schnee-Leopoard" (MacOS X 10.6). Die kommenden Versionen sollen (gerüchteweise) "Luchs" und "Berglöwe" heißen.

    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index4.html


    Erstellt: 2010-02

  • Red Hat
  • Red Hat Linux
  • Red Hat
    Red Hat Linux (W3)

    Zum Firmennamen "Red Hat" gibt es mehrere Erklärungsversuche - die allerdings nicht miteinander konkurrieren sondern eher aufeinander aufbauen.
    • Die allgemeine Variante bezieht sich auf den Symbolgehalt der Farbe rot als Zeichen der Freiheit und Herausforderung der Autorität.
    • Die persönliche Variante besagt, dass der Red-Hat-Mitbegründer Marc Ewing während seiner College-Zeit immer einen roten Hut trug. Mitschülern, die Probleme mit Technik hatten, wandten sich immer an den "Typ mit dem roten Hut".
    • Die explizite Variante besagt, dass Marc Ewing sein erstes Softwareprojekt "Red Hat 1", sein zweites Projekt "Red Hat 2", usw. nannte. Als man sich dazu entschloss, ein Linux-Projekt in Angriff zu nehmen, wurde es laut Young "Red Hat Linux" genannt.


    (E?)(L?) http://www.pcwelt.de/start/computer/pc/praxis/189397/so_kamen_10_top_produkte_zu_ihrem_namen/index4.html


  • to flog a dead horse
  • to beat a dead horse
  • to flog a dead horse
    to beat a dead horse (W3)

    Engl. "to flog a dead horse", "to beat a dead horse" = dt. "sich umsonst anstrengen", wurde in seiner übertragenen Bedeutung von von dem britischen Politiker John Bright, in Bezug auf die "Reform Bill" des Jahres 1867 benutzt. Darin wurde eine demokratischer Repräsentation im Parlament gefordert. Er meinte, das Desinteresse des Parlaments in dieser Frage zu ändern, ähnele dem Versuch auf ein totes Pferd einzuschlagen, engl. "trying to flog a dead horse to make it pull a load".

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-11


    Erstellt: 2010-02

  • Bildindex der Kunst und Architektur (bildindex)
  • bildindex
    Bildindex der Kunst und Architektur

    Die Aufnahmen stammen aus den Beständen des Deutschen Dokumentationszentrums für Kunstgeschichte. (E?)(L?) http://www.bildindex.de/


    Erstellt: 2010-02

  • Literaturmarkt (literaturmarkt)
  • literaturmarkt
    Literaturmarkt
    Buchbesprechungen von Buchneuerscheinungen

    (E?)(L?) http://www.literaturmarkt.info/


    Erstellt: 2010-02

  • Fernsehserien (serien-arena)
  • serien-arena
    Fernsehserien

    (E?)(L?) http://www.serien-arena.de/


    Erstellt: 2010-02

  • Ei-Kochzeit-Rechner (eirechner)
  • Frühstücksei-Kochzeit-Rechner (eirechner)
  • eirechner
    Frühstücksei-Kochzeit-Rechner

    Nebenbei erfährt man auch bei wieviel Grad C Wasser auf verschiedenen Höhen kocht. Auf 3000m Höhe kocht Wasser bereits bei 90°C.

    (E?)(L?) http://www.eirechner.de/


    Erstellt: 2010-02

  • Hash
  • Hash (W3)

    Im Zusammenhang mit elektronischen Schutzmaßnahmen, insbesondere der Kryptographie taucht auch immer mal wieder "Hash", "Hash-Code" oder "Hash-Funktion" auf.

    Im Wörterbuch findet man engl. "hash" = dt. "Störsignale", "Fleisch hacken", "Haschee". Dt. "Haschee" geht weiter zurück auf frz. "hachée" oder komplett "viande hachée" = "Gehacktes" oder komplett "gehacktes Fleisch", frz. "hacher" = "hacken", "zerhacken".

    Die "Hash-Funktion" hat also die Aufgabe, einen Text, oder allgemein Daten, zu zerhacken.

    Mathematisch etwas genauer formuliert, wird durch eine "Hashfunktion" eine beliebig lange Bitfolge in eine Bitfolge fester aber kürzerer Länge überführt. Das Ergebnis, die kürzere Bitfolge dient dann als Merkmal, ähnlich einem Fingerabdruck, um einen Text zu identifizieren. Dabei muß der Hashalgorithmus gewährleisten, dass eine Textänderung auch zu einem anderen "Fingerabdruck" führt. Formal dargestellt muß also gelten: aus x ungleich x' folgt h(x) ungleich h(x'). Damit können Texte digital signiert werden.

    (E?)(L?) http://www.gai-netconsult.de/de/security/secjournal/index.html
    Aktuell: Ausgabe 47 (Februar 2010)...

    Nahezu jeder setzt heute Sicherheitsvorkehrungen aller Art ein, aber nur wenige kennen sich genauer mit den Interna aus. Insbesondere um das überaus wichtige Gebiet der Kryptographie wird häufig ein großer Bogen gemacht, denn das hat ja viel mit Mathematik zu tun und da sträuben sich so manch einem die Nackenhaare. Nun muss man sicherlich nicht selber ein Spezialist der Kryptoanalyse sein, es reicht schon, wenn man auf deren Ratschläge hört. Beunruhigende Nachrichten kamen schon seit einigen Jahren von dieser Seite und betrafen die Sicherheit von "Hashfunktionen", insbesondere der verbreitete Standard "SHA-1" war ins Gerede gekommen. Da die "SHA-Familie" aber wichtiger Bestandteil vieler Sicherheitsverfahren ist, muss diese mittelfristig durch einen neuen, zukunftssicheren Algorithmus ersetzt werden. Der Artikel "Auf dem Weg zu einem neuen Standard für Hashfunktionen" geht auf die Bedeutung von Hashfunktionen im Tagesgeschäft der Kryptographie ein, wobei durch eine kurze Einführung in die Thematik auch die theoretischen Aspekte Berücksichtigung finden. Anschließend wird ein Blick auf den laufenden Hashfunktionen-Wettbewerb der NIST geworfen, wobei neben dem aktuellen Stand auch die weitere Planung bis zur Bekanntgabe des neuen Standards berücksichtigt wird.


    Der Newsletter "Security Journal 47/2010" mit einem 5-seitigen Artikel zum Thema "Auf dem Weg zu einem neuen Standard für Hashfunktionen" kann von Abonnenten, nachträglich bei "GAI NetConsult GmbH" bestellt werden.

    (E?)(L?) http://www.heise.de/newsticker/meldung/Attacken-auf-SHA-1-weiter-vereinfacht-180587.html
    (E?)(L?) http://csrc.nist.gov/groups/ST/hash/index.html
    (E?)(L?) http://ehash.iaik.tugraz.at/wiki/The_eHash_Main_Page
    (E?)(L?) http://ehash.iaik.tugraz.at/wiki/The_SHA-3_Zoo


    Erstellt: 2010-02

  • Marketing-Magazin (werbeanzeige)
  • werbeanzeige
    Marketing-Magazin

    (E?)(L?) http://www.werbeanzeige.de/


    Erstellt: 2010-02

  • Alpen
  • Alpen (W3)



    (E?)(L?) http://www.terraalpin.de/


    Erstellt: 2010-02

  • Werbe- und Marketing ABC (ccvision)
  • ccvision
    Werbe- und Marketing ABC

    (E?)(L?) http://www.ccvision.de/
    (E?)(L?) http://www.ccvision.de/de/etat-kalkulator/werbeabc/a.html


    Erstellt: 2010-02

  • Neue alte Wörter bei der Bahn (heise)
  • heise
    Neue alte Wörter bei der Bahn

    (E?)(L?) http://www.heise.de/tp/r4/artikel/32/32114/1.html
    ...
    So sollen "Flyer" wieder "Handzettel" heißen, der "Service Point" "Auskunft", der "Counter" "Schalter", "Call a bike" "Mietrad-Angebot" und die "Hotline" "Service-Nummer".
    ...
    Beibehalten wird dagegen der Ausdruck "Bahncard". Auch aus dem "Internet-Auftritt" soll kein "Zwischennetz-Auftritt" werden und aus dem "Intercity Express" kein "Zwischen-Stadt-Eilzug" ... Das "Thank you for traveling with Deutsche Bahn" wird es als Aufmerksamkeit für Reisende aus dem Ausland ebenfalls weiter geben.
    ...
    ..., weshalb aus dem "Kick-off-Meeting" eine "Auftaktveranstaltung", aus dem "Travel Management" eine "Reisestelle", aus der "Task Force" eine "Projektgruppe" und aus dem "Inhouse Meeting" ein "hauseigenes Seminar" werden soll.
    ...


    Erstellt: 2010-02

  • shambles
  • shambles (W3)

    Engl. "shambles" ("in a shambles", "is a shambles") = dt. "heilloses Durcheinander", "Chaos", bedeutet "Schlachthaus", "Fleischbank" und im übertragenen Sinn auch "Schlachtfeld", "Durcheinander".

    Der Singular engl. "shamble" bedeutet "watschelnder Gang". Das Verb engl. "shamble" bedeutet "watscheln".

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-22


    Erstellt: 2010-02

  • (W3)

    Engl. "fortune" = dt. "Glück", "Glücksfall", "Zufall" geht über frz. "fortune" zurück auf lat. "fortuna" = "Schicksal", "Zufall", "Glück", "Unglück", lat. "fortuitus" = dt. "zufällig".

    Aus dem ursprünglich eher neutralen "Zufall" blieb zumindest in engl. "fortunately" = dt. "glücklicherweise", "zum Glück" nur der "positive Zufall" zurück.

    Erstellt: 2010-02

  • (W3)

    Dt. "Sentenz" = dt. "Sinnspruch", "Denkspruch" geht zurück auf lat. "sententia" = dt. "Ansicht", "Meinung", "Spruch", "Urteil", "Sinnspruch". Das Verb zu dem der Substantiv gebildet wurde ist lat. "sentire" = "wahrnehmen", "empfinden" (vgl. dt. "sentimental").

    Erstellt: 2010-02

  • (W3)

    Engl. "fate" = dt. "Schicksal", "Geschick", "Los" geht zurück auf lat. "fatum" = dt. "Schicksal".

    Erstellt: 2010-02

  • fatal
  • fatal (W3)

    Dt. "fatal" geht zurück auf lat. "fatalis" = "vom Schicksal bestimmt".

    Erstellt: 2010-02

  • to run out of steam
  • to run out of steam (W3)

    Amerik. "to run out of steam" = dt. "an Schwung verlieren", "keine Energie mehr haben", geht zurück auf das Zeitalter der Dampfmaschinen. Wenn das Feuer abbrannte und kleiner wurde, verringerte sich auch die Dampfproduktion bis die Maschine eventuell zum Stillstand kam. Im übertragenen Sinn findet man diesen Ausdruck in den USA seit dem späten 19. Jh. century.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-02-19


    Erstellt: 2010-02

  • ()



  • (E?)(L?) http://www.drmardy.com/
    • Ifferisms: An Anthology of Aphorisms That Begin with the Word "IF"
    • I Never Metaphor I Didn't Like: A Comprehensive Compilation of History's Greatest Analogies, Metaphors, and Similes
    • Viva la Repartee: Clever Comebacks & Witty Retorts from History's Great Wits & Wordsmiths
    • Oxymoronica: Paradoxical Wit and Wisdom from History's Greatest Wordsmiths
    • Never Let a Fool Kiss You or a Kiss Fool You: Chiasmus and a World of Chiastic Quotations


    Erstellt: 2010-03

  • ()

  • Dictionary of Newfoundland English



    (E?)(L?) http://www.heritage.nf.ca/dictionary/d1ction.html
    The Dictionary which is now presented to the public is part of a plan conceived at Memorial University more than two decades ago by members of the Department of English in which the languages (especially the English language), the place- and family-names, and the folklore of Newfoundland were to be subjected to a scrutiny worthy of their importance for Newfoundlanders and their interest to others in the English-speaking world.

    Erstellt: 2010-03

  • ()



  • (E?)(L?) http://www.googleguide.com/glossary.html
    Google Guide by Category Overview (2) Favorite Features (14) Part I: Query Input (19) Part II: Understanding Results (18) Part III: Search Tools (10) Part IV: Services (12) Part V: Developing a Website (8) Appendix (13) Part III: Search Tools 1.Search Tools Intro 2.Making Google Easier with Google Tools 3.Shortcuts: Introduction 4.Shortcut: Calculator 5.Shortcut: Phone Numbers and Addresses 6.Shortcut: Street Maps 7.Shortcut: Stock Quotes 8.Shortcut: Definitions (Google Glossary) 9.Shortcut: Travel Conditions 10.Shortcut: Search by Number Other Pages Table of Contents About Google Guide: Introduction Printing Google Guide Google FAQ/Q&A Google Guide Tags Games: Where Did They Come From? Exercises/Solutions Google Blogs, etc. Google in the news Google Press Releases Google-Friends Newsletter archive Google: Search Engine Showdown News Archive Popular Searches FROOGLE driving directions photo Google name definitions

    Erstellt: 2010-

  • Multilingual Translation TO English (lookwayup)
  • Multilingual Translation FROM English (lookwayup)
  • lookwayup
    Multilingual Translation TO English
    Multilingual Translation FROM English



    (E?)(L?) http://lookwayup.com/free/dictionary.htm


    Erstellt: 2010-03

  • Crossword Solver (ojohaven)
  • ojohaven
    Crossword Solver



    (E?)(L?) http://www.ojohaven.com/fun/crossword.html


    Erstellt: 2010-03

  • Crypto Cracker (wordplays)
  • wordplays
    Crypto Cracker

    (E?)(L?) http://www.wordplays.com/p/crypto
    Crypto Cracker is a tool that can be used to crack Word Ciphers. A Word Cipher, also known as a Cryptogram or Cryptoquote, is a puzzle where one letter in the puzzle is substituted with another.

    Erstellt: 2010-03

  • The Dictionary of Mountain Bike Slang (std)
  • std
    The Dictionary of Mountain Bike Slang



    (E?)(L?) http://world.std.com/~Jimf/biking/slang.html


    Erstellt: 2010-03

  • Mountain Biking Slang (thinkquest)
  • thinkquest
    Mountain Biking Slang



    (E?)(L?) http://library.thinkquest.org/11569/gather/slang.html


    Erstellt: 2010-03

  • Hangman
  • Hangman (W3)



    (E?)(L?) http://www.hangman24.de/


    Erstellt: 2010-03

  • Heteronyms (umich)
  • umich
    Heteronyms



    (E?)(L?) http://www-personal.umich.edu/~cellis/heteronym.html


    Erstellt: 2010-03

  • Jennifer's Language Page (jennifer)
  • jennifer
    Jennifer's Language Page



    (E?)(L?) http://users.elite.net/runner/jennifers/
    At this site you can learn how to say several words and phrases in hundreds of different languages.
    My goal is to include every language, so that people will be able to say at least a few words to anyone they meet, anywhere in the world.
    • Greetings in more than 800 languages
    • "Thank you" in more than 500 languages
    • "Goodbye" in more than 450 languages
    • "How are you?" in more than 425 languages
    • "What is your name?" in more than 330 languages
    • "My name is..." in more than 275 languages
    • "Welcome" in more than 325 languages
    • "Good morning" in more than 250 languages
    • "Good afternoon" in more than 160 languages
    • "Good evening" in more than 225 languages
    • "Good night" in more than 225 languages
    • "Please" in more than 270 languages
    • "I don't understand" in more than 255 languages
    • "Do you speak English?" in more than 215 languages
    • "Yes" in more than 550 languages
    • "No" in more than 520 languages
    • Frequently Asked Questions


    Erstellt: 2010-03

  • Kiwi - Words & Phrases (chemistry)
  • chemistry
    Kiwi - Words & Phrases



    (E?)(L?) http://www.chemistry.co.nz/kiwi.htm


    Erstellt: 2010-03

  • Linguistic Phenomena/Devices (uottawa)
  • uottawa
    Linguistic Phenomena/Devices



    (E?)(L?) http://www.site.uottawa.ca/~szpak/ling-devices.html
    This is a list of some of the lesser known linguistic phenomena and devices used in English writing. You actually know what most of these are, you just didn't know what they were called. The list doesn't include the well-known devices (like synonym or metaphor). I've also left out extremely rare or poetic devices (like hypallage) and terms referring to common linguistic errors (like anacoluthon), although the line between device and error is sometimes a blurry one. The list does include some interesting linguistic phenomena that account for word formation, etc.

    aphaeresis apocope aposiopesis diaeresis dystmesis elision ellipsis eponymy hendiadys holonym hypernym hypocorisma hyponym kenning litotes meiosis meronym metonymy paronomasia periphrasis pleonasm procatalepsis syllepsis syncope synecdoche tmesis zeugma


    Erstellt: 2010-02

  • Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu
  • Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu (W3)
    Longest Place Name in the World



    (E?)(L?) http://en.wikipedia.org/wiki/Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu


    Erstellt: 2010-03

  • (W3)



    (E?)(L?) http://www.facstaff.bucknell.edu/rbeard/name.html
    Llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch This is the name of a town in North Wales. The name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave" in Welsh, has long claimed the fame of having the longest name in the world. However, there is a hill in New Zealand called Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu This Maori mouthful translates into English as "the place where Tamatea, the man with the big knees, who slid, climbed and swallowed mountains, known as 'landeater,' played his flute to his loved one." I consider this a lean short-story, however, and have serious reservations about giving New Zealand the gold, especially without photographic evidence. But you may count it if you like. However, before you make up your mind, consider the favorite of the Guinness Book of Records, the name of Bangkok (Krungthep) in Thai: Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit The translation here is pretty much the unabridged history of the city rather than a word.

    Erstellt: 2010-03

  • Pet Names (funpetnames)
  • funpetnames
    Pet Names



    (E?)(L?) http://www.funpetnames.com/
    We offer over 20,000 unique pet names. You can browse by origin, gender, breed. We even have celebrity pet names, popular pet names, cute pet names and more. Start looking for the perfect name for your pet today. When you find ones that you want to save to view later, you can add it to your very own favorites list. If you have any suggestions, feel free to contact us. Enjoy!

    Erstellt: 2010-03

  • Pet Names (petnamesworld)
  • petnamesworld
    Pet Names

    (E?)(L?) http://www.petnamesworld.com/
    Looking for the perfect pet names? PetNamesWorld.com has over 11,000 pet names to find the ones that you like best. Each name is accompanied by its meaning and place of origin. You can look up specific pet names meanings of your choice or you can simply browse through the extensive list to find the perfect ones.

    Erstellt: 2010-03

  • Native Tongue -- Discover the Hawaiian Language
  • Nautical Expressions in the Vernacular
  • Never Say Neverisms
  • The New Hacker's Dictionary
  • New Words in English
  • ODLIS: Online Dictionary of Library and Information Science
  • Official Ten Codes
  • Ohwejagehka: Ha`degaenage: Iroquois Language + Songs
  • Oly-hay Ible-bay
  • On Finally Achieving Perfect Copy
  • On-line Chinese Tools
  • Once Upon a Palindrome
  • Online Crosswords
  • Online Hieroglyphics Translator
  • Oxymorons
  • The Periodic Table of Poetry
  • PhoneSpell
  • Phonetic Alphabets (Alpha, Bravo, Charlie, Delta...)
  • Puns Galore
  • Puzzlemaker
  • Quis vocaris? Your Name in Latin
  • Rap Dictionary
  • Rhetorical Figures
  • Richard Lederer's Verbivore Page
  • Rosie's Ringers
  • Sarangworld Word Morphing
  • Sayings and Everyday Expressions
  • Scott Pakin's Automatic Complaint Letter Generator
  • Scrabble Helper
  • A Seattle Lexicon
  • Signs International
  • SignWriting
  • Silva Rhetorica: The Forest of Rhetoric
  • Sniglets
  • Slanguage.com: The Hick-to-Hip Translation Guide
  • Sounds of the World's Animals
  • Southern Word Homepage
  • Speak Jamaican
  • Spelling Test
  • Sprechen Sie Search Engines?
  • STANDS4.com
  • Steven Wright Quotes
  • Taglines Galore!
  • The Testudine and the Leporine
  • Tom Swifties
  • Tongue Twister Database
  • travalang's Translating Dictionaries
  • Twists, Slugs and Roscoes: A Glossary of Hardboiled Slang
  • Valley URL
  • Vanity License Plates
  • Wacky World of Words
  • The Wicked Good Guide to Boston English
  • A Word A Day
  • Word Finder
  • Word Frequency Indexer
  • Word Jumbles
  • Word Morphs
  • Word Slide Applet
  • A Word With You
  • The Word Wizard
  • Wordies On the Web
  • Wordles: Home of Word Fun, Word Games, Word Puzzles and Word Play!
  • Wordly Wise WordGames
  • Wordplays
  • Words & Stuff
  • Words Commonly Confused
  • Words Ending with -GRY
  • Words in a Word
  • World Wide Words
  • Ye Olde English Sayings
  • Yiddishkeit

  • Mellumrat
  • Mellumrat (W3)



    (E?)(L?) http://www.mellumrat.de/


    Erstellt: 2010-03

  • Bullet Pen
  • Bullet Pen (W3)

    Der "Bullet Pen" sollte aussehen wie eine "Gewehrkugel", die allerdings auch nicht mehr einer "Kugel" ähnelte.

    (E?)(L?) http://www.fuellhalter.de/index.php?list=KAT86


    Erstellt: 2010-03

  • Randecker Maar
  • Randecker Maar (W3)



    (E?)(L?) http://www.randecker-maar.de/


    Erstellt: 2010-03

  • Labor ingenium miseris dat
  • Not macht erfinderisch
  • Labor ingenium miseris dat
    Not macht erfinderisch (W3)

    Das Sprichwort lat. "Labor ingenium miseris dat" = dt. "Mühe gibt den Unglicklichen Einfälle" dürfte die Grundlage für das Sprichwort dt. "Not macht erfinderisch" sein.

    Erstellt: 2010-03

  • Klassiker (schoener-wohnen)
  • schoener-wohnen
    Klassiker

    (E?)(L?) http://www.schoener-wohnen.de/klassiker
    Neue Klassiker
    Jury:
    • Die Juroren im Porträt
    Produkte
    • Neue Klassiker zum Ausruhen
    • Neue Klassiker zum Abstellen
    • Neue Klassiker, die aufräumen
    • Neue Klassiker machen Licht
    • Neue Klassiker zum Träumen
    • Neue Klassiker fürs Badezimmer
    • Neue Klassiker für Tafel und Küche
    • Geräte als Neue Klassiker
    • Neue Klassiker für draußen
    "Neue Klassiker" 2006 bis 2008
    • Die erste Generation


    Erstellt: 2010-03

  • SIMEX - Singapore International Monetary EXchange
  • SIMEX (W3)

    "SIMEX" steht für "Singapore International Monetary EXchange" = dt. "Internationale Währungsbörse Singapur".

    Erstellt: 2010-03

  • to get wind of something
  • to get wind of something (W3)

    Engl. "to get wind of something" = dt. "von etwas Wind bekommen", geht auf die Eigenschaft der Luft zurück, Geräusche, Gerüche und Gerüchte zu transportieren.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-03-03


    Erstellt: 2010-03

  • (W3)

    Dt. "Fiskus" = dt. "Staatskasse", "Finazamt" oder allgemein "Staat" als Steuereintreiber und Steuerempfänger, geht zurück auf lat. "fiscus" = dt. "(Geld)korb", "Staatskasse" war ursprünglich die Privatkasse des Kaisers.

    Erstellt: 2010-03

  • FCKW - FluorChlorKohlenWasserstoff
  • FCKW (W3)

    "FCKW" ist die Abkürzung für "FluorChlorKohlenWasserstoff".

    Erstellt: 2010-03

  • CFC - ChloroFluoroCarbon
  • CFC (W3)

    "CFC" ist die Abkürzung für engl. "ChloroFluoroCarbon".

    Erstellt: 2010-03

  • Spazieren gehen ist die beste Medizin eines Menschen
  • Spazieren gehen ist die beste Medizin eines Menschen (W3)

    "Spazieren gehen ist die beste Medizin eines Menschen." soll der griechische Mediziner Hippokrates (-460 - -377) gelehrt haben.

    Erstellt: 2010-03

  • Leerzeile

  • Leerzeile (W3)

    "¶" = "Leerzeile"

    Erstellt: 2010-03

  • Apostroph

  • Apostroph (W3)

    Dieses Zeichen ersetzt ausgelassene Buchstaben und wird ohne Leerzeichen geschrieben.

    Erstellt: 2010-03

  • Gedankenstrich

  • Gedankenstrich (W3)

    Dieses Zeichen wird durch je ein Leerzeichen vom vorhergehenden und nachfolgenden Wort getrennt.

    Erstellt: 2010-03

  • ( ) / [ ] / < >
    Klammern (W3)

    Klammern werden ohne Leerzeichen vor bzw. hinter das eingeschlossene Wort / die eingeschlossenen Wörter gesetzt.

    Erstellt: 2010-03

  • §
  • Paragraph
  • §
    Paragraph (W3)

    Das Zeichen wird durch ein Leerzeichen von der nachfolgenden Zahl abgesetzt. Sollten mehrere Paragraphen angesprochen werden, so ist das Zeichen doppelt (§§) zu verwenden.

    Erstellt: 2010-03

  • &
  • und
  • &
    und
    und in Firmenbezeichnungen (W3)

    Dieses wird durch ein Leerzeichen vom vorhergehenden bzw. nachfolgenden Wort getrennt.

    Erstellt: 2010-03

  • ./.
  • gegen
  • ./.
    gegen (W3)

    Dieses Zeichen wird durch ein Leerzeichen vom vorhergehenden bzw. nachfolgenden Wort getrennt.

    Erstellt: 2010-03

  • gegen
  • Gedankenstrich

  • gegen
    Gedankenstrich (W3)

    Eine weitere Möglichkeit, das Wort „gegen“ in Zeichen auszudrücken, ist der – so z. B. im Sport.

    Erstellt: 2010-03

  • bis

  • bis (W3)

    Vor bzw. nach diesem Zeichen wird ein Leerzeichen gesetzt.

    Erstellt: 2010-03

  • /
  • pro
  • /
    pro (W3)

    Dieses Zeichen wird ohne Leerzeichen geschrieben.

    Erstellt: 2010-03

  • *
  • geboren
  • *
    geboren (W3)

    Diese Zeichen werden durch ein Leerzeichen von der nachfolgenden Datumsangabe getrennt.

    Erstellt: 2010-03

  • +
  • gestorben
  • +
    gestorben (W3)

    Diese Zeichen werden durch ein Leerzeichen von der nachfolgenden Datumsangabe getrennt.

    Erstellt: 2010-03

  • #
  • Nummer
  • #
    Nummer (W3)

    Dieses Zeichen wird durch ein Leerzeichen von der nachfolgenden Zahl getrennt.

    Erstellt: 2010-03

    de-fremdw

    • chaotisch (Griechisch)
    • Chaussee (Französisch)
    • deformiert (Latein)
    • Emanzipation (Latein)
    • Girokonto (Italienisch)
    • Interesse (Latein)
    • Internet (Englisch)
    • Journalist (Französisch)
    • Konsument (Latein)
    • Multimedia (Latein)
    • Opposition (Latein)
    • PC (Englisch)
    • Schadstoffemissionen (Latein)
    • Spionage (Französisch)
    • Tortur (Französisch)
    • Tour (Französisch)


  • Blähdeutsch
  • Blähdeutsch (W3)

    "Blähdeutsch" bezeichnet die gehäufte Verwendung von nichtssagenden Begriffen. Meist handelt es sich dabei um Neologismen, die bald wieder in der Versenkung verschwinde. Ander halten sich jedoch länger als erwartet und einige wenige schaffen es vielleicht sogar zur Seriosität. "Blähwörter" können aber auch ganz alte unschuldige Wörter sein, die durch einen bestimmten Anlass auf die Bühne gezerrt werden und allein durch ungebremste Benutzung ihre Unschuld verlieren und Blähungen verursachen.

    Erstellt: 2010-03

  • Füllwörter
  • Füllwörter (W3)

    "Füllwörter" sind keine fest umrissene Menge. Bei geschickter Nutzung kann man vermutlich jedes Wort zu einem "Füllwort" degradieren. Aber einige Wörter leiden besonders unter der Verwendung als "Füllwort". Und einige weinige sind vielleicht schon von Natur aus zum "Füllwort" verdammt. Ein "Füllwort" kann auch aus mehreren Wörtern oder einem ganzen Satz bestehen.

    Viele Partikel können als Füllwort daherkommen, obwohl sie ursprünglich durchaus ihren Sinn hatten. "Füllwörter" können auch als "Weiße Schimmel" (Pleonasmen) auftreten. Zu den Wörtern, die (auch) als "Füllwort" auftreten können gehören:
    • "echt"
    • "gegebenenfalls ... (sage ich gegebenenfalls)"
    • "gewissermaßen"
    • "gezielte Maßnahmen"
    • "großer Riese"
    • "Ich will ja nichts sagen, aber ... (ich sage es dennoch)"
    • "ich würde sagen, dass ... (ich sage)"
    • "insbesondere"
    • "irgendwie"
    • "kleiner Zwerg"
    • "Rückantwort"
    • "schlichtweg"
    • "selbstredend ... (muß ich Ihnen noch erklären, was klar vor Augen liegt)"
    • "vorprogrammiert"


    Erstellt: 2010-03

  • Nebelwerfer
  • Nebelwerfer (W3)

    "Nebelwerfer" treten meist in Form von Fachchinesisch auf. Neben den Unbeholfenen, die sich gar nicht mehr verständlich ausdrücken können, gibt es dabeiauch diejenigen, die sich nicht verständlich ausdrücken wollen. Letztere sind die eigentlichen "Nebelwerfer".

    Das Gegenstück zu den Nebelwerfern sind die "Schlagwörter".

    Erstellt: 2010-03

  • Schlagwörter
  • Schlagwörter (W3)

    "Schlagwörter" sind das Gegenstück zu den "Nebelwerfern". Wo Nebelwerfer die Gedanken durch Fachchinesisch vernebeln, schlagen Schlagwörter die Gedanken - durch Reduzierung auf weniger als das Notwendige - gleich ganz in die Flucht.

    Erstellt: 2010-03

  • Die deutsche Rechtschreibung
  • Die deutsche Rechtschreibung (W3)

    Erste Ansätze zu einer "Deutschen Rechtschreibung" kann man bei der Übersetzung lateinischer Bibeltexte sehen. Als Zeichenvorrat standen die Buchstaben des "lateinischen Alphabets" zur Verfügung. Diese recihten jedoch nicht aus, um die Lautvielfalt im Deutschen wiederzugeben, wie etwa kurze und lange Vokale. Und so entstanden zunächst eine Vielzahl unterschiedlicher "Sonderzeichen". Mit dem Aufkommen des Buchdrucks (Johannes Gutenberg, 15. Jh.) und des damit verbundenen größeren Verbreitungsgebietes der Bibel und anderer gedruckter Werke wurden diese Differenzen deutlich. Ab dem 16. Jh. wurde die Forderung nach einer Vereinheitlichung der Orthographie laut. Auch für herrschaftliche Erlasse, für Verträge und im Handel war eine einheitliche Schreibweise von Vorteil.

    Als erster Grammatiker kann Hieronymus Freyer angesehen werden, der im Jahre 1722 die "Anweisungen zur Teutschen Orthographie" veröffentlichte. Seine Nachfolge traten Johann Christoph Gottsched und Johann Christoph Adelung an. Aber das hinderte einzelne Länder und Städte nicht daran, noch lange danach eigene Lösungen zu proklamieren, wie etwa Hannover 1854, Leipzig 1857, Stuttgart 1861, Berlin 1871.

    Bei der Festlegung einheiltlicher Schreibweisen spielten auch Überlegungen zur Etymologie eine Rolle, obwohl es dabei auch zu einigen Fehlinterpretationen kam. Um gleichlautende Wörter, Homonyme, zu unterscheiden führte man unterschiedliche Schreibweisen ein (Beispiele: Lerche – Lärche, Waise – Weise). Das "Scharfe s", das "ß" war bereits im 16./17. Jh. Anlaß vieler - bis heute andauernder - Diskussionen. Im 19. Jh. ging es darum, ob das "Dehnungs-h" abgeschafft werden soll. Groß- und Kleinschreibung ein Thema, das bis heute immer wieder diskutiert wir.

    Im Jahre 1876 lud der preußische Minister Falk in Berlin zur erste Orthographischen Konferenz ein, die jedoch zu keinem einheitlichen Ergebnis führte. Und so kam wieder unter anderem eine Sonderausgabe "Preußische Schulorthographie" mit etwa 3000 Wörtern heraus, deren Anwendung Otto von Bismarck seinen Verwaltungsmitgliedern allerdings unter Strafandrohung verbot. Der - nicht amtliche - Duden umfasste zu dieser Zeit bereits ca. 30.000 Wörter. Im Jahr 1892 legte die Schweiz das "Duden-Wörterbuch" als Norm in den deutschsprachigen Kantonen fest.

    Im Jahr 1901 fand die zweite Orthographische Konferenz statt. Die wenigen dabei erzielten Gemeinsamkeiten wurden allerdings auch von Österreich und der Schweiz angenommen. Streitschriften, Arbeitskreise, Reformvorschläge, Kommissionen halten die Diskussion um die Rechtschreibung allerdings bis heute am Laufen.

    Am 01.08.1998 wurde die 1996 beschlossene neue deutsche Rechtschreibung für Schulen und Behörden eingeführt.

    Die vorerst letzte offizielle Festlegung erfolgte durch die Zustimmung der Kultusministerkonferenz im März 2006 zu den vom Rechtschreibrat überarbeiteten Regeln.

    Erstellt: 2010-03

  • PP Møbler
  • PP Møbler (W3)

    PP Møbler wurde im Jahr 1953 von den Brüdern Ejnar and Lars "Peder Pedersen" gegründet.

    (E?)(L?) http://www.pp.dk/index.php?page=about&cat=7
    ... They buy a small plot of land in Allerød and quickly gather eight young and talented cabinet makers.

    The rest is history. Today, PP Møbler is one of the few remaining cabinet making workshops in Denmark. With a production covering the Japanese and the American market with furniture from Hans J. Wegner among others, the workshop is now an internationally recognised company.


    (E?)(L?) http://www.pp.dk/index.php?page=collection&cat=1&id=11
    pp501/pp503 THE CHAIR, 1949

    „Der Runde“, wie Wegner ihn mit seiner ihm üblichen Bescheidenheit nannte, ist mit Sicherheit das berühmteste dänische Design-Möbel überhaupt - und das heisst schon was.
    ...


    Erstellt: 2010-03

  • PLC - Public Limited Company
  • PLC (W3)

    "PLC" steht für "Public Limited Company".

    Erstellt: 2010-03

  • to get the wrong end of the stick
  • to get the wrong end of the stick (W3)

    Engl. "to get the wrong end of the stick" = dt. "etwas falsch verstehen", bezieht sich auf den engl. "walking stick" = dt. "Spazierstock".

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-03-08


    Erstellt: 2010-03

  • Etymologie-Suche (oneview)
  • Etymology-Search (oneview)
  • oneview
    Etymologie-Suche
    Etymology-Search

    (E?)(L?) http://www.oneview.de/


    Erstellt: 2010-03

  • Radtouren (radweit)
  • Fahrradtouren (radweit)
  • radweit
    Radtouren
    Fahrradtouren

    (E?)(L?) http://www.radweit.de/


    Erstellt: 2010-03

  • Maps (bing)
  • bing
    Maps

    (E?)(L?) http://www.bing.com/maps/


    Erstellt: 2010-03

  • Phobos
  • Phobos-Grunt
  • Phobos
    Phobos-Grunt (W3)

    Der Marsmond "Phobos" hat einen Durchmesser von 20 Kilometer, und ähnelt einer Kartoffel. Warum die kosmische Knolle als griech. "phóbos" = "Furcht" benannt wurde, ...?

    Eine russische Marsmission trägt den Namen "Phobos-Grunt" = "Furcht-Grunzen".

    (E?)(L?) http://www.heise.de/tp/r4/artikel/32/32171/1.html
    Das Geheimnis der kosmischen Knolle
    Hans-Arthur Marsiske 02.03.2010

    Die europäische Raumsonde "Mars Express" kommt dem Marsmond Phobos so nah wie nie zuvor

    Die Raumsonde Mars Express umkreist seit Weihnachten 2003 unseren kosmischen Nachbarn. Es ist die erste Mission zu einem anderen Planeten, die Europa komplett in eigener Regie realisiert hat. Die Kameras, Spektrometer und Radarsensoren sind zumeist auf den roten Planeten selbst ausgerichtet, den die Sonde auf einem stark elliptischen Orbit umkreist. Der niedrigste Punkt der Umlaufbahn liegt etwa 250 Kilometer über der Marsoberfläche, der höchste ist 11.100 Kilometer entfernt. Dadurch kommt Mars Express immer wieder in die Nähe des Marsmondes Phobos, der den Planeten in einer Entfernung von über 9.000 Kilometern umkreist. Bei solchen Gelegenheiten ändert die Sonde dann schon mal die Blickrichtung ihrer Sensoren und schaut sich den unregelmäßig geformten Begleiter des Planeten genauer an - diesmal aus sehr geringer Entfernung.
    ...
    Die jetzigen Phobos-Vorbeiflüge von Mars Express, die bis 26. März (2010) fortgesetzt werden, dienen auch der Suche nach Landeplätzen für die russische Mission "Phobos-Grunt". Mit einem Roboterarm soll die Sonde im Jahr 2012/13 auf dem Marsmond Bodenproben einsammeln und zur Erde schicken.
    ...


    Erstellt: 2010-03

  • to get off to a flying start
  • to get off to a flying start (W3)

    Engl. "to get off to a flying start" = dt. "hervorragend wegkommen", stammt natürlich aus der Luftfahrt. Ein startendes Flugzeug muß bereits eine Mindesgeschwindigkeit erreicht haben, um abheben zu können.

    (E?)(L?) http://www.business-english.de/daily_mail_result.html?day=2010-03-05


    Erstellt: 2010-03

  • Sprechen Sie Klum? (spiegel)
  • spiegel
    Sprechen Sie Klum?

    (E?)(L?) http://www.spiegel.de/
    (E?)(L?) http://w55.de/rrHDF070EEJS30
    Was muss man bei einer "Challenge" tun? Kennen Sie schon "Q"? Nach vier Staffeln "Germany's Next Topmodel" verliert man leicht den Überblick. Zum Start der fünften Ausgabe erklärt SPIEGEL ONLINE die wichtigsten Figuren und Begriffe aus Heid [...]

    Erstellt: 2010-03

  • Reiseführer (derreisefuehrer)
  • derreisefuehrer
    Reiseführer

    Informationen zu fast allen Ländern der Erde:
    Einwohner, Staatsform, Städte, Flughäfen, Währung, Feiertage, Zollbestimmungen, Wetter.

    (E?)(L?) http://www.derreisefuehrer.com/


    Erstellt: 2010-03

  • (W3)

    Abstraktum Begriffswort, Beispiel: die Idee, siehe Konkretum

    Erstellt: 2010-

  • (W3)

    Adjektiv Eigenschaftswort, Wiewort (groß, klein ...)

    Erstellt: 2010-

  • (W3)

    Adverb Umstandswort, Beispiel: er singt laut, oft, gern ...

    Erstellt: 2010-

  • (W3)

    adverbiale Bestimmung Umstandsangabe

    Erstellt: 2010-

  • (W3)

    Adversativsatz entgegensetzender Satz

    Erstellt: 2010-

  • (W3)

    Akkusativ 4. Fall, Wen-Fall

    Erstellt: 2010-

  • (W3)

    Akkusativobjekt Satzergänzung im 4. Fall

    Erstellt: 2010-

  • (W3)

    Aktiv Tatform (des Verbs), Tätigkeitsform (ich gebe, ich habe gegeben ...)

    Erstellt: 2010-

  • (W3)

    Antonyme Gegenwörter

    Erstellt: 2010-

  • (W3)

    Apostroph Auslassungszeichen (Ohm´sches Gesetz)

    Erstellt: 2010-

  • (W3)

    Apposition Beisatz

    Erstellt: 2010-

  • (W3)

    Artikel Geschlechtswort (der, die, das, dem, ein ...)

    Erstellt: 2010-

  • (W3)

    Attribut Beifügung

    Erstellt: 2010-

  • (W3)

    Attributsatz Nebensatz, der die Stelle eines Attributs einnimmt

    Erstellt: 2010-

  • (W3)

    Dativ 3. Fall, Wem-Fall

    Erstellt: 2010-

  • (W3)

    Dativobjekt Satzergänzung im 3. Fall

    Erstellt: 2010-

  • (W3)

    Deklination Beugung des Substantivs, Adjektivs und Pronomens

    Erstellt: 2010-

  • (W3)

    Demonstrativpronomen hinweisendes Fürwort (dieser, diese, jener ...)

    Erstellt: 2010-

  • (W3)

    Denotation Grundbedeutung

    Erstellt: 2010-

  • (W3)

    Diphthong Doppelvokal, Beispiel: au, ie, ei, ai

    Erstellt: 2010-

  • (W3)

    Doppelkonsonant Beispiel: ll, ff, tt etc.

    Erstellt: 2010-

  • (W3)

    Femininum weibliches Substantiv

    Erstellt: 2010-

  • (W3)

    Finalsatz Zielsatz

    Erstellt: 2010-

  • (W3)

    Flektion, flektieren Beugung, beugen

    Erstellt: 2010-

  • (W3)

    Futur I Zukunft, Beispiel: ich werde laufen

    Erstellt: 2010-

  • (W3)

    Futur II Zukunft, Beispiel: ich werde gelernt haben

    Erstellt: 2010-

  • (W3)

    Genitiv 2. Fall, Wes-Fall

    Erstellt: 2010-

  • (W3)

    Genitivobjekt Satzergänzung im 2. Fall

    Erstellt: 2010-

  • (W3)

    Genus grammatisches Geschlecht

    Erstellt: 2010-

  • (W3)

    Grammatik besteht aus sämtlichen Regeln der Sprache, Regelwerk, interne Struktur der Sprache, Sprachlehre

    Erstellt: 2010-

  • (W3)

    Homonyme gleich klingende Wörter

    Erstellt: 2010-

  • (W3)

    Imperativ Befehlsform

    Erstellt: 2010-

  • (W3)

    Imperfekt Vergangenheitsform

    Erstellt: 2010-

  • (W3)

    Indefinitpronomen unbestimmtes Fürwort

    Erstellt: 2010-

  • (W3)

    Indikativ Wirklichkeitsform

    Erstellt: 2010-

  • (W3)

    infinite Form des Verbs unbestimmte Verbform

    Erstellt: 2010-

  • (W3)

    Infinitiv Nennform, Grundform des Verbs, Beispiel: laufen, träumen,

    Erstellt: 2010-

  • (W3)

    Infinitivsatz ist ein Satz, der aus einem erweiterten Infinitiv besteht

    Erstellt: 2010-

  • (W3)

    instrumental Angabe des Mittels und Werkszeugs

    Erstellt: 2010-

  • (W3)

    Intention Absicht, Mitteilungsabsicht

    Erstellt: 2010-

  • (W3)

    Interjektion Empfindungswort, Ausrufewort

    Erstellt: 2010-

  • (W3)

    Interrogativpronomen Fragefürwort

    Erstellt: 2010-

  • (W3)

    Interrogativsatz Fragesatz

    Erstellt: 2010-

  • (W3)

    Intonation Satzmelodie, Satzakzent

    Erstellt: 2010-

  • (W3)

    intransitives Verb nichtzielendes Verb, ein Verb, das keinen Akkusativ regieren kann

    Erstellt: 2010-

  • (W3)

    Irrealis Konjunktiv II, gedachte Möglichkeit, die keine Wirklichkeit werden kann

    Erstellt: 2010-

  • (W3)

    Kardinalzahl Grundzahl

    Erstellt: 2010-

  • (W3)

    Kasus Fall

    Erstellt: 2010-

  • (W3)

    kausal Angabe des Grundes

    Erstellt: 2010-

  • (W3)

    kausale adverbiale Bestimmung Umstandsangabe des Grundes, Beispiel: wegen des Wetters

    Erstellt: 2010-

  • (W3)

    Kausalsatz Satz, der einen Grund angibt, Begründungsatz

    Erstellt: 2010-

  • (W3)

    Kommunikation Verständigung

    Erstellt: 2010-

  • (W3)

    Komparativ 1. Steigerungsform, Beispiel: besser von gut

    Erstellt: 2010-

  • (W3)

    Kompetenz Sprachfähigkeit

    Erstellt: 2010-

  • (W3)

    Kompositum Wortzusammensetzung

    Erstellt: 2010-

  • (W3)

    Konditional Angabe der Bedingung

    Erstellt: 2010-

  • (W3)

    Konditionalsatz Bedingungssatz

    Erstellt: 2010-

  • (W3)

    Kongruenz Übereinstimmung in Numerus und Person

    Erstellt: 2010-

  • (W3)

    Konjugation Beugung des Verbs

    Erstellt: 2010-

  • (W3)

    Konjunktion Bindewort (und, oder, weil, sowohl als auch ...)

    Erstellt: 2010-

  • (W3)

    Konjunktionalsatz Gliedsatz mit Bindeworten

    Erstellt: 2010-

  • (W3)

    Konjunktiv Möglichkeitsform

    Erstellt: 2010-

  • (W3)

    Konkretum Gegenstandswort (konkreter Begriff), siehe Abstraktum

    Erstellt: 2010-

  • (W3)

    Konnotation Nebenbedeutung

    Erstellt: 2010-

  • (W3)

    konsekutiv Angabe der Folge

    Erstellt: 2010-

  • (W3)

    Konsekutivsatz Folgesatz

    Erstellt: 2010-

  • (W3)

    Konsonant Mitlaut (b, c, d, f, g, h ...)

    Erstellt: 2010-

  • (W3)

    konzessiv Angabe der Einräumung

    Erstellt: 2010-

  • (W3)

    Konzessivsatz Einräumungssatz

    Erstellt: 2010-

  • (W3)

    lokal Angabe des Ortes

    Erstellt: 2010-

  • (W3)

    lokale adverbiale Bestimmung Umstandsangabe des Ortes, Beispiel: in der Stadt

    Erstellt: 2010-

  • (W3)

    Majuskel Großbuchstabe

    Erstellt: 2010-

  • (W3)

    Maskulinum männliches Substantiv

    Erstellt: 2010-

  • (W3)

    Metapher Bedeutungsübertragung

    Erstellt: 2010-

  • (W3)

    Minuskel Kleinbuchstabe

    Erstellt: 2010-

  • (W3)

    modal Angabe der Art und Weise

    Erstellt: 2010-

  • (W3)

    modale adverbiale Bestimmung Umstandsbestimmung der Art und Weise, Beispiel: ich tue das gern

    Erstellt: 2010-

  • (W3)

    Modalsatz Gliedsatz der Art und Weise

    Erstellt: 2010-

  • (W3)

    Modus Aussageweise, Plural von Modus: Modi

    Erstellt: 2010-

  • (W3)

    Neutrum sächliches Substantiv

    Erstellt: 2010-

  • (W3)

    Nominalstil Ausdrucksweise, bei der hauptsächlich Nomen verwendet werden

    Erstellt: 2010-

  • (W3)

    Nominativ 1. Fall, Wer-Fall

    Erstellt: 2010-

  • (W3)

    Numerale Zahlwort

    Erstellt: 2010-

  • (W3)

    Numerus grammatische Zahl

    Erstellt: 2010-

  • (W3)

    Objekt Satzergänzung, Beispiel: den Hund beißen

    Erstellt: 2010-

  • (W3)

    Ordinalzahl Ordnungszahl

    Erstellt: 2010-

  • (W3)

    Partikel Wörter, die nicht gebeugt werden (Adverbien, Konjunktionen, Präpositionen)

    Erstellt: 2010-

  • (W3)

    Partizip Mittelwort

    Erstellt: 2010-

  • (W3)

    Partizip Perfekt Passiv Beispiel: gesehen

    Erstellt: 2010-

  • (W3)

    Partizip Präsens Aktiv Beispiel: lachend, schreibend

    Erstellt: 2010-

  • (W3)

    Passiv Leideform, Beispiel: du wirst geliebt

    Erstellt: 2010-

  • (W3)

    Perfekt vollendete Gegenwart, Beispiel: ich habe mich gestoßen

    Erstellt: 2010-

  • (W3)

    Personalpronomen persönliches Fürwort

    Erstellt: 2010-

  • (W3)

    Plural Mehrzahl

    Erstellt: 2010-

  • (W3)

    Plusquamperfekt vollendete Vergangenheit, Beispiel: ich hatte gelernt

    Erstellt: 2010-

  • (W3)

    Positiv Grundstufe des Adjektivs

    Erstellt: 2010-

  • (W3)

    Possessivpronomen besitzanzeigendes Fürwort (mein, dein, euer ...)

    Erstellt: 2010-

  • (W3)

    Prädikat Satzaussage

    Erstellt: 2010-

  • (W3)

    Prädikatsnomen Gleichsetzungsnominativ, Beispiel: der Mann ist ein Minister

    Erstellt: 2010-

  • (W3)

    Präposition Verhältniswort (an, auf, unter, über ...)

    Erstellt: 2010-

  • (W3)

    Präpositionalobjekt Satzglied, Ergänzung mit Verhältniswort

    Erstellt: 2010-

  • (W3)

    Präteritum Vergangenheit

    Erstellt: 2010-

  • (W3)

    Pronomen Fürwort (ich, du, wir, derjenige, viele ...)

    Erstellt: 2010-

  • (W3)

    reflexives Verb rückbezügliches Verb

    Erstellt: 2010-

  • (W3)

    Reflexivpronomen rückbezügliches Fürwort (sich, mich, dich ...)

    Erstellt: 2010-

  • (W3)

    Relativadverb bezügliches Umstandswort

    Erstellt: 2010-

  • (W3)

    Relativpronomen Bezugsfürwort (das, was ...)

    Erstellt: 2010-

  • (W3)

    Relativsatz rückbezüglicher Satz

    Erstellt: 2010-

  • (W3)

    rhetorische Frage Frage, auf die keine Antwort erwartet wird

    Erstellt: 2010-

  • (W3)

    Semantik Wortbedeutungslehre

    Erstellt: 2010-

  • (W3)

    Semikolon Strichpunkt

    Erstellt: 2010-

  • (W3)

    Singular Einzahl

    Erstellt: 2010-

  • (W3)

    Subjekt Satzgegenstand

    Erstellt: 2010-

  • (W3)

    Substantiv Hauptwort, Nennwort

    Erstellt: 2010-

  • (W3)

    Suffix Nachsilbe

    Erstellt: 2010-

  • (W3)

    Superlativ 2. Steigerungsform (höchste, weiteste, längste ...)

    Erstellt: 2010-

  • (W3)

    Synonyme Wörter mit gleicher Bedeutung

    Erstellt: 2010-

  • (W3)

    Syntax Lehre vom Satzbau

    Erstellt: 2010-

  • (W3)

    temporal Angabe der Zeit

    Erstellt: 2010-

  • (W3)

    temporale adverbiale Bestimmung Umstandsangabe der Zeit, Beispiel: um 7:00 Uhr

    Erstellt: 2010-

  • (W3)

    Tempus Zeitstufe

    Erstellt: 2010-

  • (W3)

    transitives Verb zielendes Verb, Verb, das einen Akkusativ regieren kann

    Erstellt: 2010-

  • (W3)

    Umlaut Beispiel: ä, ü, ö

    Erstellt: 2010-

  • (W3)

    Valenz Wertigkeit

    Erstellt: 2010-

  • (W3)

    Verb Tätigkeitswort, Tuwort, Zeitwort

    Erstellt: 2010-

  • (W3)

    Verbalstil Ausdrucksweise, bei der hauptsächlich Verben verwendet werden

    Erstellt: 2010-

  • (W3)

    Versalien Großbuchstaben

    Erstellt: 2010-

  • (W3)

    Vokal Selbstlaut (a, e, i, o, u)

    Erstellt: 2010-

  • (W3)

    Wortarten Substantiv, Adjektiv, Verb, Artikel, Pronomen, Präposition, Adverb, Konjunktion, Interjektion

    Erstellt: 2010-

  • ()

  • (E?)(L?) http://www.rabatte.de/


    Erstellt: 2010-03

  • Browsersize (googlelabs)
  • googlelabs
    Browsersize

    (E?)(L?) http://browsersize.googlelabs.com/


    Erstellt: 2010-03

  • Internet-Chronik (chronicl)
  • chronicl
    Internet-Chronik

    (E?)(L?) http://www.chronicl.net/
    (E?)(L?) http://www.chronicl.net/timeline/events


    Erstellt: 2010-03

  • .com
  • .edu
  • .gov
  • .mil
  • .net
  • .org
  • .com
    .edu
    .gov
    .mil
    .net
    .org (W3)

    Die Top Level Domains ".com", ".edu", ".gov", ".mil", ".org", ".net" erblickten am 15.03.1985 das Licht des Internets.

    (E?)(L?) http://www.heise.de/newsticker/meldung/Vor-25-Jahren-Als-com-edu-und-die-anderen-entstanden-954622.html
    ...
    15.03.2010 09:34
    Vor 25 Jahren: Als ".com", ".edu" und die anderen entstanden
    Am 15.03.1985 wurde im entstehenden Internet das Domain Name System eingeführt. Fortan sollten merkbare Hostnamen die Verwaltung des Netzwerkes erleichtern, das längst nicht mehr nur aus einem Dutzend Rechner bestand.

    An diesem Tag wurden sechs Namen für die sogenannten Top Level Domains (TLDs) festgelegt:
    • ".com" für kommerzielle Organisationen,
    • ".edu" für Universitäten und Schulen,
    • ".gov" für die Regierung,
    • ".mil" für das Militär,
    • ".org" für andere Organisationen und
    • ".net" für sonstige Netzwerkressourcen bildeten den Grundstock des Systems.
    Zum 25. Geburtstag des Systems stehen einschneidende Änderungen bevor, wie die Debatte um neue Top-Level-Domains zeigt.
    ...


    Erstellt: 2010-03

  • Tunica propior pallio est
  • Das Hemd ist mir näher als der Rock
  • Tunica propior pallio est
    Das Hemd ist mir näher als der Rock (W3)

    Die Lebensregel dt. "Das Hemd ist mir näher als der Rock" ist eine Lehnübersetzung des lat. "Tunica propior pallio est", wörtlich dt. "Die Tunika ist näher als der Mantel", des römischen Komödiendichters Plautus (-0250 - -0184), aus Trinummus 1154.

    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=2037&kapitel=1#gb_found
    Titus Maccius Plautus
    Der Schaz (Trinummus)

    Inhaltsverzeichnis
    • Prolog.
    • Erste Scene.
    • Erste Scene.
    • Erste Scene.
    • Erste Scene.
    • Erste Scene.
    • Uebersicht der Sylbenmaße.


    (E?)(L?) http://gutenberg.spiegel.de/?id=5&xid=2037&kapitel=7&cHash=70d0c6d3772#gb_found
    Zweite Scene.
    ...
    • Charmides.: Wer kommt da gegen uns?
    • Lysiteles.: Den Schwäher Charmides Grüßt Lysiteles.
    • Charmides.: O gebe dir der Himmel, was du willst!
    • Kallikles.: Bin ich nicht des Grußes würdig?
    • Lysiteles.: Sei willkommen, Kallikles! Dem gebührt mein erster Gruß: das Hemd ist näher als das Kleid.
    • Charmides.: Möge, was ihr schafft und rathet, durch der Götter Huld gedeih'n! Dir verlobt ist meine Tochter.
    • Lysiteles.: Wenn du nichts dawider hast.
    ...


    (E?)(L?) http://www.thelatinlibrary.com/plautus/trinummus.shtml
    (E?)(L?) http://www.ub.uni-bielefeld.de/cgi-bin/neubutton.cgi?pfad=/diglib/aufkl/humanmag/100891&seite=00000241.TIF&werk=Zeitschriften+der+Aufklaerung
    (E?)(L?) http://www.ub.uni-bielefeld.de/cgi-bin/neubutton.cgi?pfad=/diglib/aufkl/humanmag/100891&seite=00000303.TIF&werk=Zeitschriften+der+Aufklaerung
    Der Dreier, Ein Lustspiel des Plautus

    (E?)(L?) http://www.freidok.uni-freiburg.de/volltexte/4720/pdf/Lefevre_Politics_and_society_in_Plautus.pdf
    ECKARD LEFÈVRE
    Politics and society in Plautus' "Trinummus"
    ...


    Erstellt: 2010-03

  • Podcasting
  • Podcasting (W3)

    "Podcasting" ist die Kurzform von "Portable On Demand narrowCASTING".

    (E?)(L?) http://www.podcast.de/informieren/
    (E?)(L?) http://www.podcast.de/suche/?q=Etymologie&in=ShowSearch
    (E?)(L?) http://www.podcast.de/suche/?q=Etymologie&in=ShowSearch


    Erstellt: 2010-03

  • ¶ - eine Leerzeile
  • ¶ (W3)

    ¶ = eine Leerzeile

    Erstellt: 2010-03

  • i. A. - im Auftrag
  • i. A. (W3)

    i. A. = im Auftrag

    Erstellt: 2010-03

  • i. V. - in Vertretung
  • i. V. (W3)

    i. V. = in Vertretung

    Erstellt: 2010-03

  • ppa. - per procura
  • ppa. (W3)

    ppa. = per procura

    Erstellt: 2010-03

  • ’ - Apostroph
  • ’ (W3)

    ’ = Apostroph

    Erstellt: 2010-03

  • – - Gedankenstrich
  • – (W3)

    – = Gedankenstrich

    Erstellt: 2010-03

  • ( ) / [ ] / < > - Klammern
  • (W3)

    ( ) / [ ] / < > = Klammern

    Erstellt: 2010-03

  • § - Paragraph
  • § (W3)

    § = Paragraph

    Erstellt: 2010-03

  • & - und in Firmenbezeichnungen
  • & (W3)

    & = und in Firmenbezeichnungen

    Erstellt: 2010-03

  • ./. - gegen
  • ./. (W3)

    ./. = gegen

    Erstellt: 2010-03

  • – - bis
  • – (W3)

    – = bis

    Erstellt: 2010-03

  • / - pro
  • / (W3)

    / = pro

    Erstellt: 2010-03

  • * - geboren
  • * (W3)

    * = geboren

    Erstellt: 2010-03

  • + - gestorben
  • + (W3)

    + = gestorben

    Erstellt: 2010-03

  • # - Nummer
  • # (W3)

    # = Nummer

    Erstellt: 2010-03

  • Abstraktum
  • Abstraktum (W3)

    Als "Abstraktum" bezeichnet man Substantive, die etwas Nichtgegenständliches bezeichnen. Das Wort "Abstraktum" geht zurück auf lat. "abstrahere" = "abstrahieren", wörtlich "abziehen", "wegziehen". Das "Abstraktum" ist also dasjenige, bei dem man jegliche Gegenständlichkeit weggelassen hat - oder andersherum, die Quintessenz, die man aus der Gegenständlichkeit herausgezogen hat.

    Erstellt: 2010-03

  • Adjektiv
  • Adjektiv (W3)

    Das "Adjektiv", dt. "Eigenschaftswort" (spätlat. "adiectivum" = "zum Beifügen dienend(es Nomen)"), setzt sich zusammen aus lat. "-ad-" = dt. "bis", "bis zu", "nach", "zu" und lat. "icere" = dt. "legen", "werfen".

    Erstellt: 2010-03

  • Adverb
  • Adverb (W3)

    Das "Adverb", dt. "Umstandswort", setzt sich zusammen aus lat. "-ad-" = dt. "bis", "bis zu", "nach", "zu" und lat. "verbum" = dt. "Wort", "Spruch".

    Erstellt: 2010-03

  • Lex Julia
  • Lex Julia (W3)

    Die "Lex Julia" wurde von Kaiser Augustus im Jahr -19 erlassen. In dem Ehegesetz wurde Ehebruch bei Männern wie bei Frauen unter Strafe gestellt. Benannt wurde die "Lex Julia" nach Julia (-39 - +14), der Tochter von Kaiser Augustus. Diese wurde wegen ihres Lebenswandels später auf eine einsame Insel verbannt.

    (E?)(L?) http:///


    Erstellt: 2010-03

  • 2009-03-12 - Welttag gegen Internetzensur
  • Welttag gegen Internetzensur - 2009-03-12
  • 2009-03-12
    Welttag gegen Internetzensur



    (E?)(L?) http://www.heise.de/newsticker/meldung/Welttag-gegen-Internetzensur-Der-Kampf-um-Online-Kontrolle-953175.html
    12.03.2010
    Zum zweiten Mal findet am heutigen Freitag der "Welttag gegen Internetzensur" statt. Die Organisation Reporter ohne Grenzen warnt an diesem von ihr initiierten Tag vor zunehmenden Bedrohungen der Meinungs- und Informationsfreiheit im Internet.
    ...


    Erstellt: 2010-03

  • The European - Das Debattenmagazin (theeuropean)
  • theeuropean
    The European
    Das Debattenmagazin

    (E?)(L?) http://www.theeuropean.de/


    Erstellt: 2010-03

  • 3minuten-Filme (3min)
  • 3min
    3minuten-Filme
    Videoportal

    (E?)(L?) http://www.3min.de/


    Erstellt: 2010-03

  • Granada-Reisen (granada-reisen)
  • granada-reisen
    Granada-Reisen

    (E?)(L?) http://blog.granada-reisen.de/
    Granada, Las Alpujarras, Sierra Nevada und Costa

    Erstellt: 2010-03

  • Digital Artist, Photographer & Composer (philmcdarby)
  • philmcdarby
    Phil McDarby
    Digital Artist, Photographer & Composer

    (E?)(L?) http://www.philmcdarby.com/


    Erstellt: 2010-03

  • Dephlogisticated Air
  • Dephlogistierte Luft
  • Dephlogisticated Air
    Dephlogistierte Luft (W3)

    Als engl. "Dephlogisticated Air", dt. "Dephlogistierte Luft", bezeichnete Dr. Joseph Priestley (1733-????) das Gas "Sauerstoff" im 18. Jh. Diese Bezeichnung basierte auf der "Phlogiston-Theorie" (1667), mit der Feuer und Rost (von Metallen) erklärt wurden.

    "Phlogiston" geht zurück auf griech. "phlogistón" = "Verbranntes", griech. "phlogízein" = "verbrennen". Die Phlogistontheorie ging allerdings davon aus, dass beim Verbrennungsvorgang ein Stoff entweicht. Die von Lavoisier aufgestellte Oxidationstheorie (die auch heute noch gültig ist) geht allerdings davon aus, dass beim Verbrennungsvorgang Sauerstoff aus der Luft chemisch gebunden wird.

    Erstellt: 2010-03

  • ()



  • (E?)(L?) http://arbeitsblaetter.stangl-taller.at/EMOTION/Phobien.shtml
    Phobien ... damit man weiß, wovor man sich überhaupt fürchten kann ;-) zurück zur Angst Der römische Kaiser Augustus zitterte am ganzen Leibe, wenn es zu donnern begann, flüchtete in die tiefsten Kellerräume seine Palastes und bedeckte seinen Kopf mit dicken Pelzen, um das Donnern nicht zu hören. Erasmus von Rotterdam geriet aus der Fassung, wenn er einen Fisch sah. Friedrich der Große entwickelte gegen neue Uniformen und Gewänder einen solchen Widerwillen, sodass er einer Ohnmacht nahe war, wenn er einen neuen Rock anziehen sollte. Bernardin de Saint-Pierre, Newton und Paganini empfanden Furcht und ein Übelkeit, wenn sie an Wasserbecken vorübergingen. Mozart flüchtete, wenn er eine Trompete oder ein Jagdhorn hörte. Schopenhauer fürchtete sich vor jedem Rasiermesser. Carlyle wagte Zeit seines Lebens nicht, einen Fuß in einen Kaufmannsladen zu setzen. Acrophobie - Angst vor Höhe Aeronausiphobie - Angst, durch Luftkrankheit sich übergeben zu müssen Alektorophobie - Angst vor Hühnern Allodoxaphobie - Angst vor Meinungen Anemophobie - Angst vor Luft Anglophobie - Angst vor Englisch Angrophobie oder Cholerophobie - Angst wütend zu werden Anophelophobie: Angst, die Frau beim Geschlechtsverkehr zu verletzen Anuptaphobie - Angst Single zu bleiben Arachnophobie - Angst vor Spinnentieren Arithmophobie oder Numerophobie - Angst vor Zahlen Asymmetriphobie - Angst vor asymmetrischen Dingen Autophobie - Angst vor sich selbst Barophobie - Angst vor der Schwerkraft Bathophobie - Angst vor Höhe Bolshephobie - Angst vor dem Bolschevismus Cacoerphobie - Angst vor schlechtem Atem Cathisophobie - Angst vorm sitzen Chaetophobie - Angst vor Haaren Cherophobie - Angst vor Heiterkeit Chronophobie - Angst vor Uhren oder der Zeit Cligynephobie - Angst vor schönen Frauen Coprastasophobie - Angst vor Verstopfung Cyberphobie - Angst vor Computern oder an Computern arbeiten zu müssen Dendrophobie - Angst vor Bäumen Didaskaleinophobie oder Scolionophobie - Angst vor der Schule Dishabiliophobie - Angst, sich vor jem. Auszuziehen Ecophobie - Angst vor dem Zuhause Ergophobie oder Ponophobie - Angst vor Arbeit Francophobie, Gallophobie oder Galiphobie - Angst vor Französischem Geliophobie - Angst vor Gelächter Germanophobie oder Teutophobie - Angst vor Deutschem Gerontophobie - Angst vor alten Menschen Glucodermaphobie - Angst vor der "Haut", die sich auf dem Kakao bildet, wenn er zu lange steht Gnosiophobie oder Epistemophobie - Angst vor Wissen Graphophobie - Angst vorm Schreiben Gymnogasterphobie - Angst vor nackten Bäuchen Hedonophobie - Angst vor Wohlbefinden Hellenologophobie - Angst vor griechischen (Fach)ausdrücken Hydrophobie - Angst vor Wasser Hypnotopophobie - Angst vorm Bettenmachen Ideophobie - Angst vor Ideen Ithyphallophobie - Angst, eine Erektion zu sehen, daran zu denken oder zu haben Kathisophobie - Angst, sich hinzusetzen Kinesophobie - Angst vor Bewegung Laliophobie oder Lalophobie - Angst vorm Sprechen Logiozomechanophobie - Angst vor Computern Metrophobie - Angst vor Gedichten Mycogalactophobie - Angst vor Schimmelkäse Neophobie - Angst vor neuem Ophthalmophobie - Angst, angestarrt zu werden Pantophobie - Angst vor allem Papaphobie - Angst vorm Papst Papyrophobie - Angst vor Papier Paraskavedekatriaphobie - Angst vor Freitag dem 13. Pediophobie - Angst vor Puppen Peladophobie - Angst vor Glatzen Phengophobie - Angst vor Tageslicht Philophobie - Angst sich zu verlieben Phobophobie - Angst vor der Angst selbst Phronemophobie - Angst vorm Denken Pneumatiphobie - Angst vor Geistern Pognophobie - Angst vor Bärten Prosophobie - Angst vor Fortschritt Psychophobie - Angst vor dem eigenen Willen, eigenen Gedanken Pternonophobie - Angst mit Federn gekitzelt zu werden Rhytiphobie - Angst Fältchen zu bekommen Rupophobie - Angst vor Schmutz Sciophobie oder Sciaphobie - Angst vor Schatten Septophobie - Angst vor verwesenden Dingen Soceraphobie - Angst vor Schwiegereltern Somniphobie - Angst vor Schlaf Sophophobie - Angst vorm Lernen Spectrophobie - Angst in den Spiegel zu sehen Stasibasiphobie - Angst vorm Stehen Tapinophobie - Angst vor kleinen Dingen Testophobie - Angst vor Tests Tribodontophobie - Angst vorm Zähneputzen Triskadekaphobie - Angst vor der Zahl Dreizehn Uranophobie - Angst vorm Himmel Venustraphobie - Angst vor schönen Frauen Verbophobie - Angst vor Wörtern Vistiophobie - Angst vor Kleidung Wiccaphobie - Angst vor Hexen Xylophobie - Angst vor hölzernen Gegenständen Zoophobie - Angst vor Tieren

    Erstellt: 2010-02

  • Xanthippe
  • Xanthippe (W3)

    Der name der Frau des Sokrates, "Xanthippe", setzt sich zusammen aus griech. "xanthós" = "gelb" und griech. "híppos" = "Pferd".

    Erstellt: 2010-03